BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30816 (707 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M14646-1|AAA28988.1| 462|Drosophila melanogaster protein ( D.me... 31 1.5 AE014296-1707|AAF50226.2| 462|Drosophila melanogaster CG8308-PA... 31 1.5 >M14646-1|AAA28988.1| 462|Drosophila melanogaster protein ( D.melanogaster alpha-tubulin gene (alpha-4), complete cds. ). Length = 462 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -3 Query: 312 RFSSFQNILLNYFQSNVNSFPNFHKEFVTFKSL 214 RFS N+ LN FQ+N+ FP H V + L Sbjct: 254 RFSGSMNVDLNEFQTNLVPFPRIHFPLVAYAPL 286 >AE014296-1707|AAF50226.2| 462|Drosophila melanogaster CG8308-PA protein. Length = 462 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -3 Query: 312 RFSSFQNILLNYFQSNVNSFPNFHKEFVTFKSL 214 RFS N+ LN FQ+N+ FP H V + L Sbjct: 254 RFSGSMNVDLNEFQTNLVPFPRIHFPLVAYAPL 286 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,378,668 Number of Sequences: 53049 Number of extensions: 504576 Number of successful extensions: 860 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 829 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 860 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3128965752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -