BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30816 (707 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032663-5|CAA21765.1| 896|Caenorhabditis elegans Hypothetical ... 28 5.7 Z81588-2|CAB04712.1| 379|Caenorhabditis elegans Hypothetical pr... 28 7.5 U41007-7|AAA82268.3| 516|Caenorhabditis elegans Intramembrane p... 27 9.9 >AL032663-5|CAA21765.1| 896|Caenorhabditis elegans Hypothetical protein Y75B12B.6 protein. Length = 896 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/45 (26%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 28 RSIETFDRSQF-EQSFLKFNLNGNHSNTLAQLVNHLTVSSNLFVF 159 R + +FD+ + SF++FN++ + AQ + H+ +N + F Sbjct: 742 RHVYSFDKIMLNDMSFIQFNVHNESGSVFAQRILHIDTMNNGYRF 786 >Z81588-2|CAB04712.1| 379|Caenorhabditis elegans Hypothetical protein T07D10.2 protein. Length = 379 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 Query: 84 FKREPLKHACTTRKSSDCQFQSL 152 F R+ LK AC RKSS+ QSL Sbjct: 344 FNRKQLKRACPCRKSSEPLIQSL 366 >U41007-7|AAA82268.3| 516|Caenorhabditis elegans Intramembrane protease (impas)family protein 3 protein. Length = 516 Score = 27.5 bits (58), Expect = 9.9 Identities = 18/63 (28%), Positives = 33/63 (52%) Frame = -3 Query: 291 ILLNYFQSNVNSFPNFHKEFVTFKSLTRSINF*TYSRSIEGVRIKHEEIGTDSQMIYELC 112 ILL F +++ + +H+E + + SL S++F Y G I ++ + S IY +C Sbjct: 319 ILLESFSQHMSFYFYYHEESMMYASLLVSLSFGLY-HECSGNWISNDILAFAS--IYVVC 375 Query: 111 KRV 103 R+ Sbjct: 376 SRI 378 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,551,818 Number of Sequences: 27780 Number of extensions: 280092 Number of successful extensions: 680 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 663 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1645110168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -