BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30815 (690 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 26 0.25 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 23 1.8 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 22 5.4 AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochr... 22 5.4 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 26.2 bits (55), Expect = 0.25 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 514 EKCSFNELDLSIHYNVRKDLENYLRDL*SVEQ 419 EK FN LD+ Y KD EN++ L +++ Sbjct: 134 EKYGFNGLDIDWEYPEAKDKENFITLLREIKE 165 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 23.4 bits (48), Expect = 1.8 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -3 Query: 493 LDLSIHYNVRKDLENYLRDL*SVEQQQNEHTSKL 392 +D+ + VR+ + NY+ DL + NEH L Sbjct: 442 MDVVLGTEVREFVVNYIDDLLVASETLNEHLEHL 475 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 21.8 bits (44), Expect = 5.4 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 140 LTYSYNICICFYCFHDCFF 196 L S N CIC Y F F Sbjct: 41 LNLSINYCICGYIFSAILF 59 >AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 125 Score = 21.8 bits (44), Expect = 5.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +3 Query: 543 DFDQFSPNQSTHRHNIYFV 599 D D+F P RHN FV Sbjct: 107 DPDRFLPENCLKRHNFAFV 125 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,862 Number of Sequences: 336 Number of extensions: 2623 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -