BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30815 (690 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC338.13 |cog4||Golgi transport complex subunit Cog4 |Schizosa... 28 1.5 SPBP35G2.06c |nup131|Nup133a|nucleoporin Nup131|Schizosaccharomy... 27 2.6 SPAPB24D3.08c |||NADP-dependent oxidoreductase |Schizosaccharomy... 26 4.5 SPAC4F8.15 |itr1|SPAC7D4.01|myo-inositol transporter Itr1|Schizo... 26 5.9 >SPCC338.13 |cog4||Golgi transport complex subunit Cog4 |Schizosaccharomyces pombe|chr 3|||Manual Length = 738 Score = 27.9 bits (59), Expect = 1.5 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = -3 Query: 298 ESY*TLVSDTTTNKHSAESIQALISSRL--FFTFT-DEKAVVKAVKTY 164 E+Y TLV+ + +K +SI +SSRL F F D+K V K++ + Sbjct: 507 ENYITLVNSASLSKQYLKSIVDGVSSRLEEVFAFAKDQKLVKKSIDNF 554 >SPBP35G2.06c |nup131|Nup133a|nucleoporin Nup131|Schizosaccharomyces pombe|chr 2|||Manual Length = 1142 Score = 27.1 bits (57), Expect = 2.6 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 4/32 (12%) Frame = -3 Query: 517 LEKCSFNELDLSIHY----NVRKDLENYLRDL 434 L +CSF E+DL++ + KD+ YL+DL Sbjct: 998 LRECSFKEVDLALELLERATITKDVYFYLKDL 1029 >SPAPB24D3.08c |||NADP-dependent oxidoreductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 349 Score = 26.2 bits (55), Expect = 4.5 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 560 AKLIKVTLDSYKNGLRKMFI 501 AK++K TLD YK G+ +F+ Sbjct: 87 AKVVKSTLDQYKPGMDVVFV 106 >SPAC4F8.15 |itr1|SPAC7D4.01|myo-inositol transporter Itr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 575 Score = 25.8 bits (54), Expect = 5.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 423 SNSKMNIHRSYSFTSTLEFDCVSKWEYPLA 334 SNS +++ ++ T+E VSKW + LA Sbjct: 62 SNSNISLSEPHALNDTVEDQPVSKWVWVLA 91 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,396,978 Number of Sequences: 5004 Number of extensions: 43325 Number of successful extensions: 108 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -