BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30815 (690 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z73105-3|CAA97441.2| 205|Caenorhabditis elegans Hypothetical pr... 28 5.5 Z81486-7|CAB03989.1| 480|Caenorhabditis elegans Hypothetical pr... 28 7.2 >Z73105-3|CAA97441.2| 205|Caenorhabditis elegans Hypothetical protein R13.2 protein. Length = 205 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = -3 Query: 520 DLEKCSFNELDLSIHYNVRKDLENYLRDL---*SVEQQQNEHTSKL 392 D E+C + +DLS + +++D N+L + S E QQ++ +S + Sbjct: 8 DHEQCGSSVIDLSTPHTLQRDFNNWLNGIEVPNSYESQQSDSSSSV 53 >Z81486-7|CAB03989.1| 480|Caenorhabditis elegans Hypothetical protein C53A5.9 protein. Length = 480 Score = 27.9 bits (59), Expect = 7.2 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 7/41 (17%) Frame = +1 Query: 388 RVASMYVHFAVAQHFTN-------HVGNFLDPFEHYNESKD 489 R+ +FAVA TN H G FL+ FE+YN+ K+ Sbjct: 220 RLPDPRANFAVASSKTNLYVIGGTHNGQFLNKFEYYNQKKN 260 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,971,602 Number of Sequences: 27780 Number of extensions: 230322 Number of successful extensions: 537 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 537 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1581836700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -