BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30815 (690 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g20930.1 68418.m02486 protein kinase, putative nearly identic... 28 6.7 At3g43320.1 68416.m04579 hypothetical protein 28 6.7 >At5g20930.1 68418.m02486 protein kinase, putative nearly identical to protein kinase tousled gi|433052|gb|AAA32874 Length = 688 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/34 (35%), Positives = 24/34 (70%) Frame = -3 Query: 490 DLSIHYNVRKDLENYLRDL*SVEQQQNEHTSKLL 389 D S ++++ ++LEN ++DL EQQ + T+K++ Sbjct: 222 DSSEYHHLVRNLENEVKDLKDQEQQGKQKTTKVI 255 >At3g43320.1 68416.m04579 hypothetical protein Length = 510 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +3 Query: 270 VSLTNVQYDSFFTHKCVEFRTSLVGTPTLIH 362 V+L+NV + FT K +EF S+VG P +H Sbjct: 220 VTLSNVPL-TMFTDKGLEFLASVVGKPVRLH 249 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,785,960 Number of Sequences: 28952 Number of extensions: 199166 Number of successful extensions: 412 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 412 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1467502800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -