BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30812 (760 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 24 1.8 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 22 7.2 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 9.5 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 23.8 bits (49), Expect = 1.8 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -1 Query: 469 FYVELMHNMCSYFYYYFLYS 410 F++E M N+ + YY++ YS Sbjct: 16 FFIEGMTNVLDFDYYFYDYS 35 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 694 PMASTLCILCFSV*RTI 644 P+ S +C LC V RT+ Sbjct: 398 PLNSAVCALCHKVFRTL 414 Score = 21.4 bits (43), Expect = 9.5 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = -3 Query: 377 FKGLIVEVPCRHP 339 F+ L+ PC+HP Sbjct: 57 FRELLKSTPCKHP 69 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.4 bits (43), Expect = 9.5 Identities = 11/43 (25%), Positives = 15/43 (34%) Frame = -1 Query: 532 QTSSVQRYPSPRLTSRTTACEFYVELMHNMCSYFYYYFLYSVC 404 +T Q S + C+F V+L Y Y L C Sbjct: 406 ETRQQQHIMSEKRIMGEADCDFVVKLFKTFKDRKYLYMLMEAC 448 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,287 Number of Sequences: 438 Number of extensions: 3971 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -