BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30810 (656 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 24 0.96 AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory recept... 23 2.9 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 24.2 bits (50), Expect = 0.96 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 469 RGTIMGGLEQLVNSAVTNFQTYSTSNLNDLSCVTS 573 RGTI+G L+ +V + Q T N +++ V++ Sbjct: 329 RGTILGILDAIVTFLIVMIQFEMTQNSTNINFVST 363 >AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory receptor candidate 52 protein. Length = 360 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 469 RGTIMGGLEQLVNSAVTNFQTYSTSNLNDLS 561 RGTI+G L+ +V + Q T N +++ Sbjct: 329 RGTILGILDAIVTFLIVMIQFEMTQNSTNIN 359 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.317 0.130 0.372 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,261 Number of Sequences: 336 Number of extensions: 2618 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -