BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30810 (656 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY070255-1|AAL59654.1| 230|Anopheles gambiae glutathione S-tran... 26 1.2 AY070256-1|AAL59655.1| 227|Anopheles gambiae glutathione S-tran... 25 2.8 AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-tran... 24 3.7 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 24 4.9 AY070254-1|AAL59653.1| 225|Anopheles gambiae glutathione S-tran... 23 6.4 AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-tran... 23 6.4 AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-tran... 23 6.4 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 8.5 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 23 8.5 AF316635-1|AAG45163.1| 224|Anopheles gambiae glutathione S-tran... 23 8.5 >AY070255-1|AAL59654.1| 230|Anopheles gambiae glutathione S-transferase E5 protein. Length = 230 Score = 25.8 bits (54), Expect = 1.2 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 487 GLEQLVNSAVTNFQTYSTSNLNDLSCVTSIATSLDY 594 G E L ++ V ++ S+ L D+SC+ +IAT ++ Sbjct: 141 GYELLNDALVEDYIAGSSLTLADVSCIATIATMEEF 176 >AY070256-1|AAL59655.1| 227|Anopheles gambiae glutathione S-transferase E6 protein. Length = 227 Score = 24.6 bits (51), Expect = 2.8 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 487 GLEQLVNSAVTNFQTYSTSNLNDLSCVTSIAT 582 GL++L + + + DLSCV+S+AT Sbjct: 138 GLQRLERMLQSEYVAGDQLTIADLSCVSSVAT 169 >AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-transferase E1 protein. Length = 224 Score = 24.2 bits (50), Expect = 3.7 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +1 Query: 499 LVNSAVTNFQTYSTSNLNDLSCVTSIATSLDY 594 L +S T++ S + DLSC++S+A+ + + Sbjct: 144 LEDSLQTDYVAGSRLTIADLSCISSVASMVGF 175 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 23.8 bits (49), Expect = 4.9 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 6 CKRICFKLSECPTNCNFTVSSNTLR*FGRGN 98 C++ +CP N T +S T+R + R N Sbjct: 207 CRKPGHMKRDCPMESNNTPTSTTMRDYSRKN 237 >AY070254-1|AAL59653.1| 225|Anopheles gambiae glutathione S-transferase E4 protein. Length = 225 Score = 23.4 bits (48), Expect = 6.4 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = +1 Query: 424 ETFAFAAALDTNMPLRGTIMGGLEQLVNSAVTNFQTYSTSNLNDLSCVTSIAT 582 E + A +T + E L ++ V + + L DLSC+ SIA+ Sbjct: 118 EPILYYGATETPQEKIDNLYRAYELLNDTLVDEYIVGNEMTLADLSCIASIAS 170 >AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-transferase 3-8 protein. Length = 225 Score = 23.4 bits (48), Expect = 6.4 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 499 LVNSAVTNFQTYSTSNLNDLSCVTSIAT 582 L +S V + + + D SC++SIAT Sbjct: 143 LEDSLVDQYMVGESLTIADFSCISSIAT 170 >AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-transferase E7 protein. Length = 225 Score = 23.4 bits (48), Expect = 6.4 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 499 LVNSAVTNFQTYSTSNLNDLSCVTSIAT 582 L +S V + + + D SC++SIAT Sbjct: 143 LEDSLVDQYMVGESLTIADFSCISSIAT 170 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 8.5 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +1 Query: 505 NSAVTNFQTYSTSNLNDLSCVT 570 N +TNF + S L CVT Sbjct: 315 NFGITNFDNFGLSMLTVFQCVT 336 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 23.0 bits (47), Expect = 8.5 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = -1 Query: 632 DESRTIYKFVFNL*SRLVAIEVTQLKSFKLLVEYVWKLVTALFTSC 495 D S T+Y + + L ++ L SFK+ + ++ +V +F C Sbjct: 494 DYSETVYWYGLDPLWMLATNKIIFLNSFKMKLSIIFGVVHMIFGVC 539 >AF316635-1|AAG45163.1| 224|Anopheles gambiae glutathione S-transferase E1 protein. Length = 224 Score = 23.0 bits (47), Expect = 8.5 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +1 Query: 499 LVNSAVTNFQTYSTSNLNDLSCVTSIATSLDY 594 L +S +++ S + DLSC++S+A+ + + Sbjct: 144 LEDSLQSDYVAGSRMTIADLSCISSVASMVGF 175 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.317 0.130 0.372 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 648,791 Number of Sequences: 2352 Number of extensions: 11531 Number of successful extensions: 31 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -