BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30809 (731 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP35G2.06c |nup131|Nup133a|nucleoporin Nup131|Schizosaccharomy... 27 3.6 SPCC364.04c |||CASP family protein|Schizosaccharomyces pombe|chr... 26 4.8 >SPBP35G2.06c |nup131|Nup133a|nucleoporin Nup131|Schizosaccharomyces pombe|chr 2|||Manual Length = 1142 Score = 26.6 bits (56), Expect = 3.6 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -1 Query: 500 LYSVCKLFREMHGCTAFCKAVFQSVSLFIRYHKINKRETCLHVCE 366 L SVC++F G FC VF F +HK+ +E +V E Sbjct: 367 LPSVCRIFLPSPGTVVFC--VFDVT--FAMFHKVRGKEGTFYVEE 407 >SPCC364.04c |||CASP family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 633 Score = 26.2 bits (55), Expect = 4.8 Identities = 18/64 (28%), Positives = 31/64 (48%) Frame = -2 Query: 595 LYEYVCVQYSYRFRYECDAQHYLRKYQTKRWSFTPFASYSEKCMAAQHSAKLYFKVLVYS 416 LYE + + Y+ E + H L+ S +PFAS+ +K +S F+ +VY+ Sbjct: 529 LYEQMRFRDHYQKHVEPSSSH-LQTAAAYENSISPFASFRKKEAERAYSRMGSFERIVYA 587 Query: 415 FVTT 404 + T Sbjct: 588 LLRT 591 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,023,090 Number of Sequences: 5004 Number of extensions: 62495 Number of successful extensions: 108 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 345237368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -