BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30808 (740 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 27 0.16 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 22 4.5 AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 22 6.0 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 21 7.9 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 27.1 bits (57), Expect = 0.16 Identities = 17/50 (34%), Positives = 31/50 (62%), Gaps = 5/50 (10%) Frame = -1 Query: 470 KLVEFDFQMRNPEIQNNHKMLRWRAGVQLYD*YL---SHLLQE--VEENQ 336 KL+EFD +++N + N++ R R+ + L+ Y+ S+LL + V+ NQ Sbjct: 108 KLIEFDVKLQNVSLIINYENQRTRSRIHLFVRYVFVTSYLLFDYFVQRNQ 157 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +1 Query: 520 TLEGHLQDLKGFSKPKIKFEQYETPAHIAAIALYT 624 T HL+D + KP++ T + A A YT Sbjct: 177 TAAPHLRDSPNYIKPQLHVSTGSTSSPTIASATYT 211 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 246 PCFKSICFFNCRSSNIFLFVNSL 178 P FK+ FF+ S +F +NSL Sbjct: 216 PEFKAARFFSIDRSTLFSVLNSL 238 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -1 Query: 725 TQHLATLHPYSDFQGHNPA 669 T H A HPY +F G PA Sbjct: 170 THHYARYHPYPNF-GVPPA 187 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,557 Number of Sequences: 336 Number of extensions: 4131 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -