BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30805 (673 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44234| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.48 SB_10606| Best HMM Match : I-set (HMM E-Value=0) 31 0.64 SB_47759| Best HMM Match : ASC (HMM E-Value=1.49939e-42) 30 1.5 SB_29977| Best HMM Match : IL8 (HMM E-Value=1) 29 2.6 SB_52407| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_47849| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_44234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 31.9 bits (69), Expect = 0.48 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +1 Query: 400 SYPLIRLTTVFDKGNNFDLCSAFTFADLAGGLPIFHINPNDQRT 531 S+ + +F NF + F DL+ LPIFHI ND+ T Sbjct: 162 SHTATLIDNMFCNRPNFSQIADILFNDLSDHLPIFHICTNDENT 205 >SB_10606| Best HMM Match : I-set (HMM E-Value=0) Length = 872 Score = 31.5 bits (68), Expect = 0.64 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 Query: 102 DAFVIVQEAGPVDRTRRPCRSQNCH 28 D +++Q+A PVDR R C ++N H Sbjct: 614 DGSIVIQKASPVDRGRYTCTARNSH 638 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -2 Query: 93 VIVQEAGPVDRTRRPCRSQNCH 28 +++Q+A PVDR R C ++N H Sbjct: 838 IVIQKASPVDRGRYTCTARNSH 859 >SB_47759| Best HMM Match : ASC (HMM E-Value=1.49939e-42) Length = 464 Score = 30.3 bits (65), Expect = 1.5 Identities = 22/65 (33%), Positives = 30/65 (46%) Frame = +1 Query: 274 NVRTLKTVLTVDCPWLNFESNRTLAQHMSFKEDVVLSFYINGSYPLIRLTTVFDKGNNFD 453 NV TL+++ T W N A SFKE +VL Y G YP + ++ NN Sbjct: 159 NVTTLRSLYTKS--WSNVPEQFIKAYSASFKETIVLCRY--GLYP-CNMKLFTEQVNNIG 213 Query: 454 LCSAF 468 C +F Sbjct: 214 RCFSF 218 >SB_29977| Best HMM Match : IL8 (HMM E-Value=1) Length = 521 Score = 29.5 bits (63), Expect = 2.6 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -3 Query: 521 SLGLMWKMGRPPARSANVKAEHKSKLL 441 S+G +W+ G PA ++V +H S++L Sbjct: 152 SMGFLWRSGLKPAAQSSVSVQHISQIL 178 >SB_52407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +3 Query: 63 DLQALLLGRLQMHLRPPGRELEMYPGQRADPLAVRDTGVPV*NTILQRHLHR 218 D+ A + + + LRPPGR P + D + V D+ N++ +R HR Sbjct: 42 DIVAKKMAKNLLRLRPPGRRQYAAPRRPTDVILVVDSS----NSLRRREFHR 89 >SB_47849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1922 Score = 27.9 bits (59), Expect = 7.9 Identities = 25/100 (25%), Positives = 48/100 (48%), Gaps = 3/100 (3%) Frame = -3 Query: 650 QPKSQSVLLMKDLASQFLFPKMCSLS*MCSR--VRSLDNHCAVRWSLGLMWKM-GRPPAR 480 +P+ VLL + +AS+ + P C+ M R RS HC +WS G + ++ P + Sbjct: 1506 RPEDSRVLL-ETMASRCV-PGTCANKEMALRNPERSSRGHCCRKWSTGRVTEVYPGPDGK 1563 Query: 479 SANVKAEHKSKLLPLSNTVVSLIKG*DPLM*KLKTTSSLN 360 NVK + + + T +++I+ D + ++ + N Sbjct: 1564 VRNVKVQTATGKYSRTVTKIAVIQAADEELLQINSNRDRN 1603 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,816,678 Number of Sequences: 59808 Number of extensions: 469716 Number of successful extensions: 1562 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1562 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1721264831 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -