BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30803 (674 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0346 - 17776871-17781445 31 0.84 12_02_0343 - 17748882-17753396 31 0.84 >12_02_0346 - 17776871-17781445 Length = 1524 Score = 31.1 bits (67), Expect = 0.84 Identities = 19/63 (30%), Positives = 29/63 (46%) Frame = -1 Query: 653 FAIKIGDSHDEQYVLHKILVSLCI*VEVLLTRAINQSTYAIQNTCRFSKCIFHENFLHNY 474 F ++G HD YV+H +L L + R +N ST + N K I H + + + Sbjct: 558 FFEQVGKEHDSPYVMHDLLHELATNISSHEIRCLNSSTLSSIN--EIPKSIRHMSIIVDN 615 Query: 473 VHV 465 HV Sbjct: 616 RHV 618 >12_02_0343 - 17748882-17753396 Length = 1504 Score = 31.1 bits (67), Expect = 0.84 Identities = 19/63 (30%), Positives = 29/63 (46%) Frame = -1 Query: 653 FAIKIGDSHDEQYVLHKILVSLCI*VEVLLTRAINQSTYAIQNTCRFSKCIFHENFLHNY 474 F ++G HD YV+H +L L + R +N ST + N K I H + + + Sbjct: 559 FFEQVGKEHDSPYVMHDLLHELATNISSHEIRCLNSSTLSSIN--EIPKSIRHMSIIVDN 616 Query: 473 VHV 465 HV Sbjct: 617 RHV 619 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,687,642 Number of Sequences: 37544 Number of extensions: 200274 Number of successful extensions: 296 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 292 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 296 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1714968940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -