BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30798 (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 3.4 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 4.5 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 21 7.8 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 7.8 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.6 bits (46), Expect = 3.4 Identities = 17/47 (36%), Positives = 21/47 (44%) Frame = -3 Query: 240 PRLLRTSLSVPCRPSHPDGGAFRRSRGIRREEHHLLRNRPCTYRSHC 100 PR++ +V CR S P G A S R E L C Y +HC Sbjct: 704 PRIMDLD-NVMCRTSGPRGVAI-VSASTARSEQFL-----CRYEAHC 743 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 348 LRVAPEEHPVLLTEAPLNPKAXREKM 425 LR+ P H V+ T +NP EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = -1 Query: 209 HADHHTLMAGPSDDRGEYGARSIISCETG 123 H H +DD+ + R ++SC +G Sbjct: 1686 HCTIHRTQVKETDDKICFTMRPVVSCASG 1714 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.4 bits (43), Expect = 7.8 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -1 Query: 551 VGDTVAGVQHDTGGTTGRVQREHGLDGDVHG 459 VGD +A ++ D G + E+G G G Sbjct: 42 VGDDIAWMKFDKEGRLRAINPEYGFFGVAPG 72 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +3 Query: 111 GMCKAGFAGD 140 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,303 Number of Sequences: 438 Number of extensions: 4988 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -