BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30797 (570 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46027| Best HMM Match : Fibrinogen_C (HMM E-Value=0.24) 28 6.2 SB_13713| Best HMM Match : zf-C2H2 (HMM E-Value=3.8e-23) 27 8.2 SB_30491| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_46027| Best HMM Match : Fibrinogen_C (HMM E-Value=0.24) Length = 901 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 424 YWKLNNILNTYIIVSSLENIPVYICIYTK 338 YWK +N+ NT I L+N + + Y+K Sbjct: 439 YWKNHNVYNTESIADGLDNSDMKLHTYSK 467 >SB_13713| Best HMM Match : zf-C2H2 (HMM E-Value=3.8e-23) Length = 1084 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = -3 Query: 292 CAFCGNCFVILNRSQSHDACYLILLRIPRRWV*IVRLCNN 173 C +CG F N ++H C+ P RW +R CN+ Sbjct: 652 CVYCGKTFARSNVLKAHVRCH---TGNPNRWDVRMRACND 688 >SB_30491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1516 Score = 27.5 bits (58), Expect = 8.2 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 4/62 (6%) Frame = -3 Query: 376 LENIPVYICIYTKPTNHSS--MFTXKP*LTCAFCGNCFVILNRSQS--HDACYLILLRIP 209 + NI + I + NH S M+T +P LTC+ C + +N + C+L+ I Sbjct: 793 INNIKTFGVIVQEYVNHDSFEMYTKRPPLTCSSCTSSRRRINTCTGLPIERCFLVYCSIE 852 Query: 208 RR 203 R Sbjct: 853 GR 854 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,445,083 Number of Sequences: 59808 Number of extensions: 340038 Number of successful extensions: 671 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 671 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1349364063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -