BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30797 (570 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z99281-20|CAE18022.1| 214|Caenorhabditis elegans Hypothetical p... 28 5.4 Z48334-3|CAA88310.1| 471|Caenorhabditis elegans Hypothetical pr... 27 9.5 >Z99281-20|CAE18022.1| 214|Caenorhabditis elegans Hypothetical protein Y57G11C.39 protein. Length = 214 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +2 Query: 20 DFTRLRDSNTVASLYTNTPDILS 88 D TRL++ N +A+LYT+ D +S Sbjct: 147 DITRLQEKNRIANLYTSLEDDVS 169 >Z48334-3|CAA88310.1| 471|Caenorhabditis elegans Hypothetical protein F10B5.3 protein. Length = 471 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = -1 Query: 459 PYCLSFTSPTSYTGNXXXXXXXXXXLAHSRTYLYIYAFIPNQQIIAQC 316 P S +PT+ GN HS L+I+ + + Q +AQC Sbjct: 376 PNVSSIFAPTNPAGNIPIQCSLCPFSTHSTDLLFIHLAMQHAQELAQC 423 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,924,606 Number of Sequences: 27780 Number of extensions: 257623 Number of successful extensions: 482 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 482 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1187327456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -