BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30792 (309 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0934 - 9273325-9273807,9273898-9274062,9274155-9274235,927... 27 4.0 05_01_0294 - 2291175-2291223,2291591-2292039,2292143-2292211,229... 26 6.9 >12_01_0934 - 9273325-9273807,9273898-9274062,9274155-9274235, 9274347-9274475,9274590-9274661,9274758-9274826, 9275143-9275514,9275590-9275703,9275729-9275848 Length = 534 Score = 26.6 bits (56), Expect = 4.0 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 5/58 (8%) Frame = -2 Query: 308 FFFHVLLKTFKMKTIYFVLLISVCAVSAIYLPDDSNSA-----DLDKYKSESFGSKLY 150 FFFHV+L M+T ++L + A A DDS+S+ D D + SF S+++ Sbjct: 310 FFFHVVLIRKGMRTYDYILAMRE-AAQAFDPFDDSDSSSDESIDFDSPERPSFLSRIF 366 >05_01_0294 - 2291175-2291223,2291591-2292039,2292143-2292211, 2292397-2292449,2292492-2294478 Length = 868 Score = 25.8 bits (54), Expect = 6.9 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +1 Query: 187 SRSAEFESSGKYIALTAQTLISKTK*MVFILKVFSS 294 ++ ++F ++ KY LTA TLI K K IL+V+ S Sbjct: 731 NKRSDFSTALKYANLTADTLIKKLK---KILEVYMS 763 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,712,438 Number of Sequences: 37544 Number of extensions: 41074 Number of successful extensions: 147 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 147 length of database: 14,793,348 effective HSP length: 71 effective length of database: 12,127,724 effective search space used: 375959444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -