BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30791 (648 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 25 0.83 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 1.1 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 23 1.9 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 7.8 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 24.6 bits (51), Expect = 0.83 Identities = 12/41 (29%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +1 Query: 280 IRKKEDFSGVWLHHSFILDTSAHGE-VSKPNPHSSTDLRTG 399 ++KK DF V+L + TS HG+ + + + D ++G Sbjct: 460 MKKKADFIAVFLSENNYPTTSIHGDRLQRQREEALADFKSG 500 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 24.2 bits (50), Expect = 1.1 Identities = 21/84 (25%), Positives = 36/84 (42%), Gaps = 1/84 (1%) Frame = +2 Query: 326 SSWILVLTAKSASQILIARLICGLAFGCNIIVVIMYIGELCQTSTRATATVIITFLFSIG 505 S W + + SA+ ILI +CG+ N V+ G + S + +++ +L + Sbjct: 654 SGWAIGAMSFSATGILITLFVCGVFLKHNDTPVVRASGR--ELSYVLLSGILLCYLVTF- 710 Query: 506 ALASYSLGWVCSYET-VCYFCITL 574 AL VC + FC T+ Sbjct: 711 ALVLRPTDIVCGIQRFAAGFCFTV 734 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 276 MYSEERRFQWRVASSFFHP 332 +YS E+ WR+ S+F P Sbjct: 219 VYSWEQNRSWRITHSYFMP 237 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.4 bits (43), Expect = 7.8 Identities = 15/51 (29%), Positives = 20/51 (39%) Frame = +2 Query: 473 TVIITFLFSIGALASYSLGWVCSYETVCYFCITLSVIYIIFMFALVKESSG 625 TVI L + L C+Y V L V ++ AL+ E SG Sbjct: 55 TVIGNILVCVAVFLVRKLRRPCNYLLVSLAVSDLCVALLVMPMALLYEISG 105 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,392 Number of Sequences: 438 Number of extensions: 4140 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -