BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30789 (684 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 40 0.043 UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 35 1.6 UniRef50_Q5FFA1 Cluster: Similar to competence protein F; n=2; E... 33 4.9 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 40.3 bits (90), Expect = 0.043 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = +3 Query: 39 RFVDELTAHLVLSGYWNP 92 R+VDELTAHLVLSGYW+P Sbjct: 158 RWVDELTAHLVLSGYWSP 175 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 35.1 bits (77), Expect = 1.6 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 224 WYLPVRTHKRSYHQ 265 WYLP RTHKRSYH+ Sbjct: 572 WYLPARTHKRSYHR 585 >UniRef50_Q5FFA1 Cluster: Similar to competence protein F; n=2; Ehrlichia ruminantium|Rep: Similar to competence protein F - Ehrlichia ruminantium (strain Gardel) Length = 230 Score = 33.5 bits (73), Expect = 4.9 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 1/68 (1%) Frame = -3 Query: 505 FDVSLPVST-AKNYTIKTATLFFKVFSSTPIKSSGPRARKNNYQQSWQGGSASSKYAHLS 329 FD +L + T AK K +LF V + P+ R R+ Y Q+ A SKY ++ Sbjct: 90 FDNTLHIKTYAKWMYNKNPSLFNNVTTIIPVPIHKKRLRQRKYNQATLLARALSKYCNIP 149 Query: 328 CSLRVLIR 305 + VL+R Sbjct: 150 LEISVLVR 157 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 666,445,687 Number of Sequences: 1657284 Number of extensions: 12868790 Number of successful extensions: 24772 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 24190 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24767 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 53305790091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -