BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30786 (767 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 24 4.5 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 24 5.9 AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. 24 5.9 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 7.9 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 24.2 bits (50), Expect = 4.5 Identities = 17/61 (27%), Positives = 25/61 (40%) Frame = +2 Query: 422 ALIRTFAANITRLSLSVPALQQAIVSGKYDAVVTESFFNDAEAGYGAVLQVPWILLSSVS 601 +LI A +L L +IV AVV F GYG V +P ++++ Sbjct: 275 SLIAVCARFFLQLPWMWSILLGSIVGAVSPAVVVPRLFRLRTKGYGVVKGIPTLIIAVAG 334 Query: 602 I 604 I Sbjct: 335 I 335 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 23.8 bits (49), Expect = 5.9 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -2 Query: 64 MLLFVNRLAFKNDHSVVTC 8 +++F+N + FKN + TC Sbjct: 601 LIMFINMMLFKNQEPLDTC 619 >AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. Length = 401 Score = 23.8 bits (49), Expect = 5.9 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +2 Query: 479 LQQAIVSGKYDAVVT 523 LQ A+++G YD +VT Sbjct: 263 LQAAVIAGSYDEIVT 277 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.4 bits (48), Expect = 7.9 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 614 LEAIIDXVPVDHHHTAAVQQRPNPPWASGT 703 L+A + VPV + +PNPPWA T Sbjct: 388 LQAFVVCVPVQ-------RPKPNPPWADRT 410 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 808,501 Number of Sequences: 2352 Number of extensions: 16773 Number of successful extensions: 95 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -