BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30786 (767 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 22 7.2 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 22 7.2 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 21.8 bits (44), Expect = 7.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 445 GSEGPDQRHTSISVSLVVH 389 GS GP+ + S SVS VH Sbjct: 38 GSYGPEAGNVSCSVSWEVH 56 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.8 bits (44), Expect = 7.2 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = +2 Query: 209 LCVFPIPSRSHNSLGKGIVEALLGAGHEVTWATPFPPKEST 331 L VF +PS S + GI L +T PP E T Sbjct: 232 LLVFYVPSESGEKVTLGISALLSMTVFLMTIRESLPPTEKT 272 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,065 Number of Sequences: 438 Number of extensions: 4834 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -