BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30786 (767 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g20850.1 68417.m03025 subtilase family protein contains simil... 29 2.6 At4g12400.1 68417.m01960 stress-inducible protein, putative simi... 29 4.5 At1g62740.1 68414.m07081 stress-inducible protein, putative simi... 29 4.5 At3g15390.1 68416.m01951 expressed protein low similarity to PRL... 28 6.0 At2g02880.1 68415.m00238 mucin-related similar to putative mucin... 28 6.0 At1g33400.1 68414.m04135 tetratricopeptide repeat (TPR)-containi... 28 6.0 At2g41900.1 68415.m05183 zinc finger (CCCH-type) family protein ... 28 7.9 At2g03780.1 68415.m00338 translin family protein similar to SP|Q... 28 7.9 >At4g20850.1 68417.m03025 subtilase family protein contains similarity to Tripeptidyl-peptidase II (EC 3.4.14.10) (TPP-II) (Tripeptidyl aminopeptidase) (Swiss-Prot:P29144) [Homo sapiens] Length = 1380 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -3 Query: 264 TIPLPRELWLREGIGNTQST-WYARADVTTHTKKSSNWRHLI 142 TIP R ++LREG QST W + D H + +SN + L+ Sbjct: 643 TIPTSRGIYLREGTACRQSTEWTIQVDPKFH-EGASNLKELV 683 >At4g12400.1 68417.m01960 stress-inducible protein, putative similar to sti (stress inducible protein) [Glycine max] GI:872116; contains Pfam profile PF00515 TPR Domain Length = 530 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 5/56 (8%) Frame = -2 Query: 613 VRHYGDAGQQDPGHLKYCS-----VTRLGIVEEGLRDDRVVFPADDRLLQRWYREG 461 V+HY +A +++P ++ S T+LG + EGL+D D + + R+G Sbjct: 389 VKHYSEAIKRNPNDVRAYSNRAACYTKLGALPEGLKDAEKCIELDPSFTKGYSRKG 444 >At1g62740.1 68414.m07081 stress-inducible protein, putative similar to sti (stress inducible protein) [Glycine max] GI:872116; contains Pfam profile PF00515 TPR Domain Length = 571 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 5/56 (8%) Frame = -2 Query: 613 VRHYGDAGQQDPGHLKYCS-----VTRLGIVEEGLRDDRVVFPADDRLLQRWYREG 461 VRHY +A +++P + S T+LG + EGL+D D L+ + R+G Sbjct: 402 VRHYTEAIKRNPKDPRAYSNRAACYTKLGAMPEGLKDAEKCIELDPTFLKGYSRKG 457 >At3g15390.1 68416.m01951 expressed protein low similarity to PRLI-interacting factor N [Arabidopsis thaliana] GI:11139276 Length = 468 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 Query: 242 NSLGKGIVEALLGAGHEVTWATPFPPKESTKGLKI 346 NS+ G V +++G + T PKE+TK LKI Sbjct: 98 NSISNGTVSSVIGKEYARTRPISNAPKEATKPLKI 132 >At2g02880.1 68415.m00238 mucin-related similar to putative mucin GI:18071389 [Oryza sativa] Length = 314 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +2 Query: 311 FPPKESTK-GLKIIDVSATASVSEMIDMNDQRNADAG 418 FP KEST ++ IDV A A V +M + D+R +G Sbjct: 73 FPVKESTATAIEEIDVEAKAFVEDMNEHWDERRGKSG 109 >At1g33400.1 68414.m04135 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 798 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -2 Query: 547 LGIVEEGLRDDRVVFPADDRLLQRWYREGQPRD-IGSEGPDQRHTSISVSL 398 LG+++E LRD D + WYR G+ +G+ R ++S+SL Sbjct: 119 LGLLKESLRDCHRALRIDPYYAKAWYRRGKLNTLLGNYKDAFRDITVSMSL 169 >At2g41900.1 68415.m05183 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) and Pfam domain, PF00023: Ankyrin repeat Length = 716 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/52 (26%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = -3 Query: 426 NAIPASAFLWSFMSIISLTDAVALTSIIFRPLVDSLGGNGVAHVT-SWPAPS 274 +A+P+ + + +SL + PL S GNG++H +WP P+ Sbjct: 371 SAVPSPRSNADYAAALSLLPGSPSGVSVMSPLSPSAAGNGMSHSNMAWPQPN 422 >At2g03780.1 68415.m00338 translin family protein similar to SP|Q99598 Translin-associated protein X (Translin-associated factor X) {Homo sapiens}; contains Pfam profile PF01997: Translin family Length = 287 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +3 Query: 627 SMXCRSITTIPLLFNNAPTPHGLLGQAD 710 S+ R + IPLL +NAPT + LLG AD Sbjct: 259 SVHVRGLEYIPLLGDNAPTSY-LLGAAD 285 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,882,575 Number of Sequences: 28952 Number of extensions: 361702 Number of successful extensions: 1001 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 982 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1001 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1721869952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -