BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30784 (604 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC18B11.05 |gpi18||pig-V|Schizosaccharomyces pombe|chr 1|||Manual 27 2.1 SPAC13G6.01c |rad8|SPAC5H10.14c|ubiquitin-protein ligase E3 |Sch... 25 8.5 >SPAC18B11.05 |gpi18||pig-V|Schizosaccharomyces pombe|chr 1|||Manual Length = 426 Score = 27.1 bits (57), Expect = 2.1 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +1 Query: 127 VLILGVLCTYQRLFDEILCSYSIYLYRISSVLNIKKNIAMKLFFFFF 267 V++LG++ + +F + Y++YL S+ + +K A + F+ F Sbjct: 129 VVLLGIVSCFASIFFHAIACYALYLL-TKSIFSNQKMTAYTVIFYCF 174 >SPAC13G6.01c |rad8|SPAC5H10.14c|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1133 Score = 25.0 bits (52), Expect = 8.5 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 182 HNISSKSRWYVQSTP 138 H+ISS++RW + TP Sbjct: 673 HSISSQNRWVITGTP 687 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,506,961 Number of Sequences: 5004 Number of extensions: 50366 Number of successful extensions: 103 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 264253462 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -