BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30784 (604 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0634 + 12441374-12441383,12441991-12442187,12442270-124424... 31 0.93 >02_02_0634 + 12441374-12441383,12441991-12442187,12442270-12442485, 12442561-12442677 Length = 179 Score = 30.7 bits (66), Expect = 0.93 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = +1 Query: 103 RIADIGYGVLILGVLCTYQRLFDEILCSYSIYLYRISSVLNIKKNIAMKLFFFFF 267 R AD+ G+L+LGVLC L + S + SSV+ + ++ A+ + +F Sbjct: 70 RQADVSIGLLLLGVLCHIATLVSKYTSSTGDSI-NSSSVMQLSRSCAIVMLIAYF 123 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,093,479 Number of Sequences: 37544 Number of extensions: 321660 Number of successful extensions: 525 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 524 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1431112012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -