BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30780 (667 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0731 - 6516894-6517473,6517485-6519574 32 0.47 12_01_0727 + 6446283-6449300 32 0.47 01_05_0161 - 18757122-18757331,18757931-18758488 31 0.62 11_01_0799 + 7035380-7036148,7036587-7037080 31 1.1 04_02_0008 + 8473198-8475523,8475618-8475967 30 1.4 11_01_0679 - 5550070-5550201,5550309-5550454,5550577-5551219 30 1.9 02_01_0232 + 1543597-1543800,1544189-1544377,1544695-1544859,154... 30 1.9 01_01_0145 + 1327172-1327362,1327491-1328169 29 2.5 01_05_0195 - 19111983-19112477,19112646-19113950,19114053-191143... 29 3.3 12_01_0715 - 6230393-6231559,6233234-6234553 29 4.4 10_08_0961 + 21869612-21869773,21869869-21869956,21870047-218702... 29 4.4 12_01_0741 + 6649988-6653065 28 5.8 11_01_0606 + 4831102-4833033 28 5.8 01_01_0418 - 3142659-3145622 28 5.8 02_01_0302 - 2021221-2023305 28 7.7 >12_01_0731 - 6516894-6517473,6517485-6519574 Length = 889 Score = 31.9 bits (69), Expect = 0.47 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +3 Query: 513 NSTIGYIAPNAFHGVHDLYAVNLSNNNLKSLHP 611 NS G I P+ G+ L ++LSNNNL L P Sbjct: 633 NSISGNIPPSICDGIKSLQLIDLSNNNLTGLIP 665 >12_01_0727 + 6446283-6449300 Length = 1005 Score = 31.9 bits (69), Expect = 0.47 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +3 Query: 513 NSTIGYIAPNAFHGVHDLYAVNLSNNNLKSLHP 611 NS G I P+ G+ L ++LSNNNL L P Sbjct: 626 NSISGNIPPSICDGIKSLQLIDLSNNNLTGLIP 658 >01_05_0161 - 18757122-18757331,18757931-18758488 Length = 255 Score = 31.5 bits (68), Expect = 0.62 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -3 Query: 158 LPGPCPHVVANSLTSVQPLNNGYT*FLES 72 LP P PHV++N + +Q L N YT L S Sbjct: 180 LPRPTPHVISNIIKIMQNLRNAYTLALPS 208 >11_01_0799 + 7035380-7036148,7036587-7037080 Length = 420 Score = 30.7 bits (66), Expect = 1.1 Identities = 23/80 (28%), Positives = 35/80 (43%), Gaps = 5/80 (6%) Frame = +3 Query: 195 GESINKTVKKDKDA---DNLLDQYEDYEPAEYQEVLYNEDRPCPRDCICSVSQ--GYRQA 359 G+ K+ KK K+ NLL + +++ +++E P DC S+ Q G Sbjct: 333 GKPRGKSAKKLKELAGITNLLSSGSILKESDFASDVHSETDSTPSDCSVSLLQKMGVEMC 392 Query: 360 KCSFLEIGTQKFGDDILDLV 419 S E+ K G LDLV Sbjct: 393 GLSLEEVAESKLGGQKLDLV 412 >04_02_0008 + 8473198-8475523,8475618-8475967 Length = 891 Score = 30.3 bits (65), Expect = 1.4 Identities = 21/71 (29%), Positives = 32/71 (45%) Frame = +3 Query: 405 ILDLVVENADPRYPINLDDFMFKKLGLHQVATVKIVNSTIGYIAPNAFHGVHDLYAVNLS 584 +L+L V N D PI L + LGL + N+ + + P +H+L +N S Sbjct: 383 MLNLSVNNLDGSIPIELVNISSLSLGLD------LSNNKLSGLIPQQVGTLHNLGHLNFS 436 Query: 585 NNNLKSLHPET 617 NN L P + Sbjct: 437 NNQLSGQIPSS 447 >11_01_0679 - 5550070-5550201,5550309-5550454,5550577-5551219 Length = 306 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 276 EYQEVLYNEDRPCPRDCICSVSQGYRQAKCSFLEIGTQKF 395 + +E Y++ CP D C V Q + QAK L +QKF Sbjct: 225 DLEECPYDDCDNCPSDNNCKVLQAFSQAKNLALVADSQKF 264 >02_01_0232 + 1543597-1543800,1544189-1544377,1544695-1544859, 1545199-1545459,1546059-1546271,1546365-1546587, 1547974-1548149 Length = 476 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 311 LSQRLHMLCISGIQTSQVQLPRNRY 385 L QRL +LCI G+ T +++ R+RY Sbjct: 445 LMQRLTVLCIRGVSTYPIKIIRSRY 469 >01_01_0145 + 1327172-1327362,1327491-1328169 Length = 289 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -2 Query: 345 PEIQSICSLW-DRACPRCTKPLGIPRVR 265 P S W DRACP C +P+G R R Sbjct: 70 PRAAPAASSWMDRACPSCNEPIGDIRCR 97 >01_05_0195 - 19111983-19112477,19112646-19113950,19114053-19114322, 19118884-19118950,19119229-19119284,19119530-19119590, 19120181-19120297,19120570-19120682,19120774-19120848, 19121464-19122045,19122056-19122271,19122372-19122497, 19126152-19126190,19126266-19126360,19126423-19126962, 19127102-19127327,19127385-19127437,19127534-19127701, 19128353-19128707,19128785-19128876,19129891-19129993 Length = 1717 Score = 29.1 bits (62), Expect = 3.3 Identities = 30/130 (23%), Positives = 51/130 (39%), Gaps = 3/130 (2%) Frame = +3 Query: 243 LLDQYEDYEPAEYQEVLYNEDRPCPRDCICSVSQGYRQAKCSFLEIGTQKFGDDILDLVV 422 + + E Y+P+ Y+E L+ R + S+S +E G DD +DL Sbjct: 1492 IFPESEQYDPSSYEEYLHWYSGVTRRYLVPSISDD--------VEAGPSLQPDDSIDLQY 1543 Query: 423 ENADPRYPINLDDF--MFKKLGLHQVATVKIVNSTIGYIAPNAFHGV-HDLYAVNLSNNN 593 + P +D M KK + +T + + + F V HDL + + + Sbjct: 1544 QAKAPMIRKAVDKLHGMVKKAKMAMTSTADTTTQALVFEFLHGFQDVLHDLGEIKENGGS 1603 Query: 594 LKSLHPETFA 623 S H E+ A Sbjct: 1604 ATSPHVESAA 1613 >12_01_0715 - 6230393-6231559,6233234-6234553 Length = 828 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 513 NSTIGYIAPNAFHGVHDLYAVNLSNNNLKSLHP 611 NS G I P+ + L ++LSNNNL L P Sbjct: 548 NSISGNIPPSICDRIKSLQLIDLSNNNLTGLIP 580 >10_08_0961 + 21869612-21869773,21869869-21869956,21870047-21870277, 21870371-21870538,21870808-21871001,21871151-21871234, 21871315-21871434,21871621-21871714,21871813-21871973, 21873237-21873313,21873738-21873932,21874487-21874559, 21874635-21874721,21874906-21875043,21875181-21875383, 21875469-21875631,21875861-21875992 Length = 789 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -2 Query: 366 CTWLVCIPEIQSICSLWDRACPRCTKPLGIPRVRNPHI 253 C L C P IQ + R CP C P G VR I Sbjct: 752 CFHLFCSPCIQRNLEIRHRKCPGCGTPFGQSDVREVKI 789 >12_01_0741 + 6649988-6653065 Length = 1025 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 513 NSTIGYIAPNAFHGVHDLYAVNLSNNNL 596 NS +G + ++ + +LY +NLSNN L Sbjct: 464 NSFVGIVELTSYSKLQNLYVLNLSNNKL 491 >11_01_0606 + 4831102-4833033 Length = 643 Score = 28.3 bits (60), Expect = 5.8 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +3 Query: 483 LHQVATVKI-VNSTIGYIAPNAFHGVHDLYAVNLSNNNLKSLHPET 617 L Q+ +K+ N+ GYI P F G+ ++ +NLS N+ P T Sbjct: 419 LQQLEVIKLQTNNFSGYI-PRIFSGMTNMEVLNLSANSFSGEIPST 463 >01_01_0418 - 3142659-3145622 Length = 987 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +3 Query: 513 NSTIGYIAPNAFHGVHDLYAVNLSNNNLKSLHPE 614 N+ IG + ++F + DL+++NLSNN L + E Sbjct: 431 NNFIGTLELSSFWKLPDLFSLNLSNNKLSVVDGE 464 >02_01_0302 - 2021221-2023305 Length = 694 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +3 Query: 477 LGLHQVATVKIVNSTIGYIAPNAFHGVHDLYAVNLSNNNLKSLHPE 614 LGL +A + + ++ + P+ F + L+ ++LSNN PE Sbjct: 129 LGLPDLALIHLNSNRFCGVVPDTFRRLRLLHELDLSNNRFVGAFPE 174 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,970,995 Number of Sequences: 37544 Number of extensions: 350986 Number of successful extensions: 1258 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1258 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1679486824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -