BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30780 (667 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13884| Best HMM Match : LRR_1 (HMM E-Value=6.3e-06) 33 0.28 SB_50335| Best HMM Match : Baculo_11_kDa (HMM E-Value=2.1) 29 3.4 SB_45368| Best HMM Match : fn2 (HMM E-Value=3.1e-32) 29 3.4 SB_55282| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_49900| Best HMM Match : GETHR (HMM E-Value=5e-18) 29 4.5 SB_47959| Best HMM Match : rve (HMM E-Value=3e-29) 29 4.5 SB_18529| Best HMM Match : DUF1388 (HMM E-Value=3.5) 29 4.5 SB_16977| Best HMM Match : Involucrin (HMM E-Value=0.012) 28 5.9 SB_25378| Best HMM Match : CNH (HMM E-Value=0.037) 28 5.9 SB_2841| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_2192| Best HMM Match : rve (HMM E-Value=4e-23) 28 7.9 >SB_13884| Best HMM Match : LRR_1 (HMM E-Value=6.3e-06) Length = 575 Score = 32.7 bits (71), Expect = 0.28 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = +3 Query: 513 NSTIGYIAPNAFHGVHDLYAVNLSNNNL 596 N++I IAP+AF G+ +L ++NL +NN+ Sbjct: 137 NNSISAIAPHAFKGLDNLQSLNLRHNNI 164 >SB_50335| Best HMM Match : Baculo_11_kDa (HMM E-Value=2.1) Length = 370 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 291 LYNEDRPCPRDCICSVSQGYRQAK 362 L N + CP C C +S+GYR +K Sbjct: 119 LDNVGKLCPSHCFCLLSRGYRASK 142 >SB_45368| Best HMM Match : fn2 (HMM E-Value=3.1e-32) Length = 1206 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 507 IVNSTIGYIAPNAFHGVHDLYAVNLSNNNLKSLHPETF 620 I N+ I I F V DL +NL NN + ++ +TF Sbjct: 1120 IGNNLIKDIPSGVFANVRDLQVLNLHNNEITTIDEDTF 1157 >SB_55282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1565 Score = 28.7 bits (61), Expect = 4.5 Identities = 20/48 (41%), Positives = 25/48 (52%), Gaps = 9/48 (18%) Frame = +2 Query: 491 GCYCKNREQH-----DWLYRPQCFPWCP*PLRSQP----IQQQPKEPS 607 G YC+N+EQ D+ +R C P P+ SQP IQ P EPS Sbjct: 1314 GVYCRNKEQRSGKCKDFRFRFACSD-IPRPVPSQPSVPSIQDVPDEPS 1360 >SB_49900| Best HMM Match : GETHR (HMM E-Value=5e-18) Length = 1044 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 510 VNSTIGYIAPNAFHGVHDLYAVNLSNNNLKSLHPETFA 623 V + I YI AF DL +NL+NN ++ + FA Sbjct: 4 VRANIQYIDDFAFEKARDLVYINLANNPIEVIEEGAFA 41 >SB_47959| Best HMM Match : rve (HMM E-Value=3e-29) Length = 622 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +3 Query: 249 DQYEDYEPAEYQEVLYNEDRPCPRDCICSVSQGYRQAKCSFLEIGTQKFGDDILDLV 419 +Q ED +E + NE R C R IC + Y + K +KF ++ D+V Sbjct: 490 EQLEDNPTVPLEEHIDNEGRKCKRQKICESQKTYNE-KMKKQTQKAKKFKFNVYDIV 545 >SB_18529| Best HMM Match : DUF1388 (HMM E-Value=3.5) Length = 435 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 211 KPSRKTKTPTTYWINMRITNPRNTKRFCTTRTGP 312 K SRKTKT + +++ RNTK T+T P Sbjct: 89 KTSRKTKTSSNTKTSLKTKTSRNTKTSRNTKTKP 122 >SB_16977| Best HMM Match : Involucrin (HMM E-Value=0.012) Length = 247 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +3 Query: 249 DQYEDYEPAEYQEVLYNEDRPCPRDCICSVSQGYRQAKCSFLEIGTQKFGDDILDLV 419 +Q ED +E + NE R C R IC + Y + K +KF ++ D+V Sbjct: 115 EQLEDNPTVPLEEHIDNEGRKCKRKKICESQKTYNE-KMKKQTQKAKKFKFNVYDIV 170 >SB_25378| Best HMM Match : CNH (HMM E-Value=0.037) Length = 346 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/53 (24%), Positives = 28/53 (52%) Frame = +3 Query: 192 FGESINKTVKKDKDADNLLDQYEDYEPAEYQEVLYNEDRPCPRDCICSVSQGY 350 F ES+ + + D +++ +ED P+++++ L D P P+ + +GY Sbjct: 286 FDESLQLFARLETDPTHVIGLFEDLLPSDFRKQLEYPDEP-PKLLMSETEKGY 337 >SB_2841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3297 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +3 Query: 249 DQYEDYEPAEYQEVLYNEDRPCPRDCICSVSQGYRQAKCSFLEIGTQKFGDDILDLV 419 +Q ED +E + NE R C R IC + Y + K +KF ++ D+V Sbjct: 1089 EQLEDNPTVPLEEHIDNEGRKCKRKKICESQKTYNE-KMKKPTQKAKKFKFNVYDIV 1144 >SB_2192| Best HMM Match : rve (HMM E-Value=4e-23) Length = 491 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +3 Query: 249 DQYEDYEPAEYQEVLYNEDRPCPRDCICSVSQGYRQAKCSFLEIGTQKFGDDILDLV 419 +Q ED +E + NE R C R IC + Y + K +KF ++ D+V Sbjct: 359 EQLEDNPTVPLEEHIDNEGRKCKRKKICESQKTYNE-KMKKPTQKAKKFKFNVYDIV 414 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,783,107 Number of Sequences: 59808 Number of extensions: 413330 Number of successful extensions: 1266 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1265 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1717720750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -