BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30780 (667 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g36180.1 68417.m05148 leucine-rich repeat family protein cont... 32 0.39 At1g08590.1 68414.m00952 CLAVATA1 receptor kinase (CLV1) similar... 29 2.1 At5g61140.1 68418.m07670 DEAD box RNA helicase, putative similar... 29 2.8 At2g06140.1 68415.m00675 hypothetical protein 29 2.8 At5g49290.1 68418.m06100 leucine-rich repeat family protein cont... 29 3.7 At3g11330.1 68416.m01378 leucine-rich repeat family protein 28 4.9 At1g09910.1 68414.m01115 expressed protein 28 4.9 At4g29180.1 68417.m04175 leucine-rich repeat protein kinase, put... 28 6.4 At2g23300.1 68415.m02781 leucine-rich repeat transmembrane prote... 28 6.4 At1g74190.1 68414.m08592 leucine-rich repeat family protein cont... 28 6.4 At1g21690.2 68414.m02715 replication factor C 37 kDa, putative S... 28 6.4 At1g21690.1 68414.m02714 replication factor C 37 kDa, putative S... 28 6.4 At3g44530.1 68416.m04786 transducin family protein / WD-40 repea... 27 8.5 At3g25020.1 68416.m03127 disease resistance family protein conta... 27 8.5 At3g24982.1 68416.m03125 leucine-rich repeat family protein, 5' ... 27 8.5 At1g58190.1 68414.m06605 leucine-rich repeat family protein cont... 27 8.5 >At4g36180.1 68417.m05148 leucine-rich repeat family protein contains protein kinase domain, Pfam:PF00069; contains leucine-rich repeats, Pfam:PF00560 Length = 1136 Score = 31.9 bits (69), Expect = 0.39 Identities = 20/71 (28%), Positives = 30/71 (42%) Frame = +3 Query: 408 LDLVVENADPRYPINLDDFMFKKLGLHQVATVKIVNSTIGYIAPNAFHGVHDLYAVNLSN 587 LDL +N P+ L GL V + + + + P F + L VNLS+ Sbjct: 505 LDLSKQNMSGEVPVELS-------GLPNVQVIALQGNNFSGVVPEGFSSLVSLRYVNLSS 557 Query: 588 NNLKSLHPETF 620 N+ P+TF Sbjct: 558 NSFSGEIPQTF 568 >At1g08590.1 68414.m00952 CLAVATA1 receptor kinase (CLV1) similar to receptor-like protein kinase (Ipomoea nil) (U77888) Length = 1029 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 432 DPRYPINLDDFMFKKLGLHQVATVKIVNSTIGYIAP 539 D + DF K+ LH+ TV +V + GYIAP Sbjct: 863 DSNLEARIADFGLAKMMLHKNETVSMVAGSYGYIAP 898 >At5g61140.1 68418.m07670 DEAD box RNA helicase, putative similar to ASC-1 complex subunit P200 [Homo sapiens] GI:12061185; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF02889: Sec63 domain Length = 2146 Score = 29.1 bits (62), Expect = 2.8 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 193 SANLSIKPSRKTKTPTTYWINMRITNPRNTKRFCTTRTGPVPETAYALYLRDT 351 + L K S K P+T I + T+ RN+ R R V + A+ L L DT Sbjct: 2036 NVRLQKKDSDGKKKPSTLEIRLEKTSKRNSSRALAPRFPKVKDEAWWLVLGDT 2088 >At2g06140.1 68415.m00675 hypothetical protein Length = 633 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 Query: 198 ESINKTVKKDKDADNLLDQYEDYEPAEYQE 287 ES+++ + DK DNL + E +EP E +E Sbjct: 588 ESLDRILDLDKKVDNLTTRIEGHEPMESEE 617 >At5g49290.1 68418.m06100 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 888 Score = 28.7 bits (61), Expect = 3.7 Identities = 16/62 (25%), Positives = 32/62 (51%) Frame = +3 Query: 438 RYPINLDDFMFKKLGLHQVATVKIVNSTIGYIAPNAFHGVHDLYAVNLSNNNLKSLHPET 617 RY + F F + L+ + + + ++ + + P + L A+NLS+N L S P++ Sbjct: 683 RYDSYIGAFQFSEGTLNSMYGLDLSSNELSGVIPAELGDLFKLRALNLSHNFLSSHIPDS 742 Query: 618 FA 623 F+ Sbjct: 743 FS 744 >At3g11330.1 68416.m01378 leucine-rich repeat family protein Length = 499 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +3 Query: 531 IAPNAFHGVHDLYAVNLSNNNLKSLHPETFA 623 + P AF + L +NLSNN L+S+ P++ A Sbjct: 212 LLPEAFGRIQGLLVLNLSNNKLESI-PDSIA 241 >At1g09910.1 68414.m01115 expressed protein Length = 675 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +3 Query: 531 IAPNAFHGVHDLYAVNLSNNNL 596 IA + HGV+ LYAVN+ N L Sbjct: 621 IARHGIHGVYMLYAVNIPGNRL 642 >At4g29180.1 68417.m04175 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 911 Score = 27.9 bits (59), Expect = 6.4 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +3 Query: 543 AFHGVHDLYAVNLSNNNLKSLHPETFA 623 AF + L +++LSNNNLK + PE A Sbjct: 429 AFRNLSLLESLDLSNNNLKGIVPEFLA 455 >At2g23300.1 68415.m02781 leucine-rich repeat transmembrane protein kinase, putative Length = 773 Score = 27.9 bits (59), Expect = 6.4 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +3 Query: 489 QVATVKIVNSTIGYIAPNAFHGVHDLYAVNLSNNNLK-SLHPETFA 623 +V T+ + NS + P+ + +L ++NLSNN+L SL E FA Sbjct: 76 RVVTLSLPNSNLVGSIPSDLGFLQNLQSLNLSNNSLNGSLPVEFFA 121 >At1g74190.1 68414.m08592 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.1 [Lycopersicon pimpinellifolium] gi|1184075|gb|AAC15779 Length = 965 Score = 27.9 bits (59), Expect = 6.4 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +3 Query: 537 PNAFHGVHDLYAVNLSNNNLKSLHPETFA 623 P F G+ +L A+NLS+NNL + P++ + Sbjct: 796 PVEFGGLLELRALNLSHNNLSGVIPKSIS 824 >At1g21690.2 68414.m02715 replication factor C 37 kDa, putative Similar to SWISS-PROT:P35249 activator 1 37 kDa subunit (Replication factor C 37 kDa subunit, A1 37 kDa subunit, RF-C 37 kDa subunit, RFC37) [Homo sapiens]; contains Pfam domain, PF00004: ATPase, AAA family Length = 327 Score = 27.9 bits (59), Expect = 6.4 Identities = 21/85 (24%), Positives = 39/85 (45%), Gaps = 3/85 (3%) Frame = +3 Query: 327 ICSVSQGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLDDFMFK--KLGLHQVAT 500 + S+SQG + ++L+ T+ FG I + N P+ + + +F K G +A Sbjct: 190 LSSISQGDLRRAITYLQSATRLFGSTITSTDLLNVSGVVPLEVVNKLFTACKSGDFDIAN 249 Query: 501 VKIVNSTI-GYIAPNAFHGVHDLYA 572 ++ N GY A + + D+ A Sbjct: 250 KEVDNIVAEGYPASQIINQLFDIVA 274 >At1g21690.1 68414.m02714 replication factor C 37 kDa, putative Similar to SWISS-PROT:P35249 activator 1 37 kDa subunit (Replication factor C 37 kDa subunit, A1 37 kDa subunit, RF-C 37 kDa subunit, RFC37) [Homo sapiens]; contains Pfam domain, PF00004: ATPase, AAA family Length = 339 Score = 27.9 bits (59), Expect = 6.4 Identities = 21/85 (24%), Positives = 39/85 (45%), Gaps = 3/85 (3%) Frame = +3 Query: 327 ICSVSQGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLDDFMFK--KLGLHQVAT 500 + S+SQG + ++L+ T+ FG I + N P+ + + +F K G +A Sbjct: 202 LSSISQGDLRRAITYLQSATRLFGSTITSTDLLNVSGVVPLEVVNKLFTACKSGDFDIAN 261 Query: 501 VKIVNSTI-GYIAPNAFHGVHDLYA 572 ++ N GY A + + D+ A Sbjct: 262 KEVDNIVAEGYPASQIINQLFDIVA 286 >At3g44530.1 68416.m04786 transducin family protein / WD-40 repeat family protein contains 6 (4 significant) WD-40 repeats (PF0400); nuclear protein HIRA, mouse, PIR:S68141 Length = 1051 Score = 27.5 bits (58), Expect = 8.5 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 2/82 (2%) Frame = -3 Query: 533 DITNR--AVHDFYSSNLVKSEFFEHEVV*INRVAGIRVFDHEIKDIIAELLCTDFEEAAL 360 D+ NR +HD SS LV S+ V + R+ + + D++ ELL + + + Sbjct: 711 DLFNRKCVLHDSLSS-LVSSDVNLSSTVKVKRMKNWYLLIFLVGDLVVELLSWYEDSSVI 769 Query: 359 GLSVSLRYRAYAVSGTGPVLVV 294 L +++ + +S +G LVV Sbjct: 770 DLDCTIKVISVKLSKSGSPLVV 791 >At3g25020.1 68416.m03127 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 890 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 537 PNAFHGVHDLYAVNLSNNNLKSLHPE 614 PN F +H+L + LSNN + PE Sbjct: 406 PNVFKTLHNLEYIALSNNRISGKFPE 431 >At3g24982.1 68416.m03125 leucine-rich repeat family protein, 5' fragment contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611 (19 copies); contains similarity to GB:AAD13301 from [Lycopersicon esculentum] Length = 681 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 537 PNAFHGVHDLYAVNLSNNNLKSLHPE 614 PN F +H+L + LSNN + PE Sbjct: 438 PNVFKTLHNLEYIALSNNRISGKFPE 463 >At1g58190.1 68414.m06605 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 1784 Score = 27.5 bits (58), Expect = 8.5 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 513 NSTIGYIAPNAFHGVHDLYAVNLSNNNLKSLHPETFA 623 N IG I P + A+NLS+N+L L PE+F+ Sbjct: 756 NELIGEI-PRELGDFQRIRALNLSHNSLSGLVPESFS 791 Score = 27.5 bits (58), Expect = 8.5 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = +3 Query: 489 QVATVKIVNSTIGYIAPNAFHGVHDLYAVNLSNNNLKSLHP 611 Q++ +++ N + + P+ DL+ +NLSNN L + P Sbjct: 1177 QLSVIELQNCNLENV-PSFIQHQKDLHVINLSNNKLTGVFP 1216 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,639,978 Number of Sequences: 28952 Number of extensions: 281040 Number of successful extensions: 922 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 864 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 921 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1403159472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -