BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30779 (677 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 2.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 2.7 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 4.7 DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse tr... 22 6.2 DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse tr... 22 6.2 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.0 bits (47), Expect = 2.7 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -3 Query: 297 QRLPRPSNRNALL-LHGRNRQGGGTYPCGLTR 205 ++LP ++ LL L+G NR+ G Y C + R Sbjct: 372 RQLPGTGRQSELLRLNGINREDRGMYQCIVRR 403 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.0 bits (47), Expect = 2.7 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -3 Query: 297 QRLPRPSNRNALL-LHGRNRQGGGTYPCGLTR 205 ++LP ++ LL L+G NR+ G Y C + R Sbjct: 372 RQLPGTGRQSELLRLNGINREDRGMYQCIVRR 403 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -3 Query: 99 LSKKKGLRTAVPEHHIARIIPKTLANF 19 LS +KG R +P+ + + +PK F Sbjct: 1053 LSMEKGTRPMIPDDNTSLALPKNEGPF 1079 >DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse transcriptase protein. Length = 127 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 11 VHVKLANVFGMIRAM*CSGTAVLKPFFLLSDRLTYSLQI 127 VH + N+F +I++ T + FL+S + T L+I Sbjct: 55 VHNHIQNIFKIIKSTNEKITRYIIRMFLISQQKTSKLKI 93 >DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse transcriptase protein. Length = 110 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 11 VHVKLANVFGMIRAM*CSGTAVLKPFFLLSDRLTYSLQI 127 VH + N+F +I++ T + FL+S + T L+I Sbjct: 38 VHNHIQNIFKIIKSTNEKITRYIIRMFLISQQKTSKLKI 76 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,531 Number of Sequences: 438 Number of extensions: 4648 Number of successful extensions: 27 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -