BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30776 (487 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 21 4.5 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 21 4.5 AF264718-1|AAF75271.1| 125|Tribolium castaneum putative cytochr... 21 4.5 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 21 7.9 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 7.9 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 7.9 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 21.4 bits (43), Expect = 4.5 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 362 RTLARSSCRDPASR*TALYLRYPGSRAYIAVHQ 264 RT+A + P Y YPG+ A +A +Q Sbjct: 192 RTIALGAFYQPLQPFPPPYPFYPGTSAMLAAYQ 224 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +3 Query: 354 KGSCWCTLSQHSLRSMTYRIYVNKSCE*RTRPTCQWF 464 +GS + + + TY+I VN + TC+ F Sbjct: 467 RGSVFVRFTHLQHQPFTYKITVNNQSNGNRKGTCRIF 503 >AF264718-1|AAF75271.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q6 protein. Length = 125 Score = 21.4 bits (43), Expect = 4.5 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +2 Query: 326 MRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDT 445 ++D+ K + + V T+NDLQ+L+ +K+T Sbjct: 15 LQDIQTKVREEILSVVGKEKIPTYNDLQELKYTKRCIKET 54 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 267 MDSNVCSRSWIPQVQSSLPR 326 +DS V SR+W + + +PR Sbjct: 273 LDSLVASRTWPARPVNQVPR 292 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 20.6 bits (41), Expect = 7.9 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 143 IVVLGSGGVGKSAL 184 + +LGS G GK+ L Sbjct: 107 LAILGSSGAGKTTL 120 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 20.6 bits (41), Expect = 7.9 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 143 IVVLGSGGVGKSAL 184 + +LGS G GK+ L Sbjct: 107 LAILGSSGAGKTTL 120 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,653 Number of Sequences: 336 Number of extensions: 2956 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11315916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -