BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30775 (726 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1660| Best HMM Match : DUF1241 (HMM E-Value=0.35) 65 6e-11 SB_46988| Best HMM Match : HEAT (HMM E-Value=8.6e-06) 32 0.54 SB_29357| Best HMM Match : LRR_1 (HMM E-Value=0.00026) 30 1.7 SB_24621| Best HMM Match : DUF164 (HMM E-Value=0.39) 30 1.7 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_32974| Best HMM Match : NblA (HMM E-Value=3.7) 30 2.2 SB_3044| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_48325| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_15785| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_44978| Best HMM Match : REJ (HMM E-Value=3.9e-13) 29 3.8 SB_30986| Best HMM Match : 7tm_1 (HMM E-Value=0) 29 5.1 SB_39349| Best HMM Match : 7tm_1 (HMM E-Value=0) 29 5.1 SB_36821| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_8196| Best HMM Match : NGP1NT (HMM E-Value=0.89) 29 5.1 SB_47201| Best HMM Match : SAM_1 (HMM E-Value=7.1e-09) 28 6.7 SB_4186| Best HMM Match : ADK (HMM E-Value=0.094) 28 6.7 SB_59414| Best HMM Match : Complex1_LYR (HMM E-Value=7.7) 28 8.9 SB_54637| Best HMM Match : DUF1621 (HMM E-Value=3) 28 8.9 SB_10566| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 28 8.9 SB_45927| Best HMM Match : WD40 (HMM E-Value=9e-18) 28 8.9 >SB_1660| Best HMM Match : DUF1241 (HMM E-Value=0.35) Length = 142 Score = 64.9 bits (151), Expect = 6e-11 Identities = 38/99 (38%), Positives = 57/99 (57%), Gaps = 1/99 (1%) Frame = +2 Query: 140 VTSLVLPVLIRPVLTQLEK-YDLAASQTLRAALTKAEAAVPGLNYDLVAGIMRRADIPVN 316 + +L L V+IRPVL +L K YD + ++ A +AE PG+ +LV+GIM++ +N Sbjct: 11 IPNLALSVIIRPVLDELSKEYDEDTVKKIQKAFHQAEKENPGITQELVSGIMKKESDGIN 70 Query: 317 MNESLLRLQGSLTDSECTDLRLNRTEEAFQELNKKSAAL 433 MN++LL G TD + NR E F L KK+ A+ Sbjct: 71 MNKALLSCAGYNTD----EYNTNREEHEFVNLTKKARAV 105 >SB_46988| Best HMM Match : HEAT (HMM E-Value=8.6e-06) Length = 1231 Score = 31.9 bits (69), Expect = 0.54 Identities = 21/64 (32%), Positives = 33/64 (51%) Frame = +2 Query: 317 MNESLLRLQGSLTDSECTDLRLNRTEEAFQELNKKSAALKKILSRIPDEITDRKTFLETI 496 M + LRLQ ++E + + EEA Q+L +K A KK+ +E+ RK+ + Sbjct: 1159 MRQKQLRLQREREEAEHQEAERKKEEEAKQKLKQKEDARKKL-----EEVERRKSQQQAA 1213 Query: 497 KEIA 508 KE A Sbjct: 1214 KEAA 1217 >SB_29357| Best HMM Match : LRR_1 (HMM E-Value=0.00026) Length = 521 Score = 30.3 bits (65), Expect = 1.7 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 2/82 (2%) Frame = +2 Query: 395 EAFQELNKKSAALKKILSRIPDEITDR--KTFLETIKEIASAIKKLLDAVNEVSTYTPGP 568 E E KKS +L+ L ++I D+ +FLE +K S + L VN++S + Sbjct: 330 EIIAEALKKSTSLRS-LDLEGNKIGDKGGTSFLEALKVNESLVDLTLMPVNDISRHIHEE 388 Query: 569 GKQVLEQRKREFVKYSKRFSTT 634 K++L+ R ++ S R S T Sbjct: 389 IKELLQGRAKQRPSTSSRKSDT 410 >SB_24621| Best HMM Match : DUF164 (HMM E-Value=0.39) Length = 566 Score = 30.3 bits (65), Expect = 1.7 Identities = 29/111 (26%), Positives = 48/111 (43%) Frame = +2 Query: 308 PVNMNESLLRLQGSLTDSECTDLRLNRTEEAFQELNKKSAALKKILSRIPDEITDRKTFL 487 P+++ + LL L L T L+ T++ K + KK+LS ++ K L Sbjct: 36 PLSLTKKLLSLTKKLLS--LTKKPLSLTKKLLSLTKKPLSLTKKLLSLTKKLLSLTKKLL 93 Query: 488 ETIKEIASAIKKLLDAVNEVSTYTPGPGKQVLEQRKREFVKYSKRFSTTLK 640 K++ S KKLL ++ + T K++L K+ K S T K Sbjct: 94 SLTKKLLSLTKKLLSLTKKLLSLT----KKLLSLTKKLLSLTKKLLSLTKK 140 Score = 29.1 bits (62), Expect = 3.8 Identities = 37/154 (24%), Positives = 64/154 (41%) Frame = +2 Query: 179 LTQLEKYDLAASQTLRAALTKAEAAVPGLNYDLVAGIMRRADIPVNMNESLLRLQGSLTD 358 L L K L+ ++ L +LTK ++ L ++ +++ + LL L L Sbjct: 50 LLSLTKKPLSLTKKL-LSLTKKPLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLS 108 Query: 359 SECTDLRLNRTEEAFQELNKKSAALKKILSRIPDEITDRKTFLETIKEIASAIKKLLDAV 538 T L+ T++ K + KK+LS ++ K L K++ S KKLL Sbjct: 109 --LTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLT 166 Query: 539 NEVSTYTPGPGKQVLEQRKREFVKYSKRFSTTLK 640 ++ + T K++L K+ K S T K Sbjct: 167 KKLLSLT----KKLLSLTKKLLSLTKKLLSLTKK 196 Score = 29.1 bits (62), Expect = 3.8 Identities = 30/111 (27%), Positives = 47/111 (42%), Gaps = 5/111 (4%) Frame = +2 Query: 323 ESLLRLQGSLTDS--ECTDLRLNRTEEAFQELNKKSAALKKILSRIPDEITDRKTFLETI 496 +SL + SLT T L+ T++ K + KK+LS ++ K L Sbjct: 325 QSLTKKLLSLTKKPLSLTKKPLSLTKKLLSLTKKLQSLTKKLLSLTKKLLSLTKKLLSLT 384 Query: 497 KEIASAIKKLLDAVNEVSTYTPGP---GKQVLEQRKREFVKYSKRFSTTLK 640 K++ S KKLL ++ + T P K++L K+ K S T K Sbjct: 385 KKLQSLTKKLLSLTKKLLSLTKKPLSLTKKLLSLTKKLLSLTKKLLSLTKK 435 Score = 29.1 bits (62), Expect = 3.8 Identities = 32/119 (26%), Positives = 51/119 (42%), Gaps = 8/119 (6%) Frame = +2 Query: 308 PVNMNESLLRLQG---SLTDS--ECTDLRLNRTEEAFQELNKKSAALKKILSRIPDEITD 472 P+++ + LL L SLT T L+ T++ K + KK+LS ++ Sbjct: 345 PLSLTKKLLSLTKKLQSLTKKLLSLTKKLLSLTKKLLSLTKKLQSLTKKLLSLTKKLLSL 404 Query: 473 RKTFLETIKEIASAIKKLLDAVNEVSTYTPGP---GKQVLEQRKREFVKYSKRFSTTLK 640 K L K++ S KKLL ++ + T P K++L K+ K S T K Sbjct: 405 TKKPLSLTKKLLSLTKKLLSLTKKLLSLTKKPLSLTKKLLSLTKKPLSLTKKLLSLTKK 463 Score = 29.1 bits (62), Expect = 3.8 Identities = 39/159 (24%), Positives = 66/159 (41%), Gaps = 5/159 (3%) Frame = +2 Query: 179 LTQLEKYDLAASQTLRAALTKAEAAVPGLNYDLVAGIMRRADIPVNMNESLLRLQG---S 349 L L K L+ ++ L + K ++ L L ++ P+++ + LL L S Sbjct: 366 LLSLTKKLLSLTKKLLSLTKKLQSLTKKL-LSLTKKLLSLTKKPLSLTKKLLSLTKKLLS 424 Query: 350 LTDS--ECTDLRLNRTEEAFQELNKKSAALKKILSRIPDEITDRKTFLETIKEIASAIKK 523 LT T L+ T++ K + KK+LS ++ K L K++ S KK Sbjct: 425 LTKKLLSLTKKPLSLTKKLLSLTKKPLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKK 484 Query: 524 LLDAVNEVSTYTPGPGKQVLEQRKREFVKYSKRFSTTLK 640 LL ++ + T K++L K+ K S T K Sbjct: 485 LLSLTKKLLSLT----KKLLSLTKKLLSLTKKLLSLTKK 519 Score = 28.7 bits (61), Expect = 5.1 Identities = 38/161 (23%), Positives = 67/161 (41%) Frame = +2 Query: 158 PVLIRPVLTQLEKYDLAASQTLRAALTKAEAAVPGLNYDLVAGIMRRADIPVNMNESLLR 337 P+ + L L K L+ ++ L +LTK ++ L ++ +++ + LL Sbjct: 71 PLSLTKKLLSLTKKLLSLTKKL-LSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLS 129 Query: 338 LQGSLTDSECTDLRLNRTEEAFQELNKKSAALKKILSRIPDEITDRKTFLETIKEIASAI 517 L L T L+ T++ K + KK+LS ++ K L K++ S Sbjct: 130 LTKKLLS--LTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLT 187 Query: 518 KKLLDAVNEVSTYTPGPGKQVLEQRKREFVKYSKRFSTTLK 640 KKLL ++ + T K++L K+ K S T K Sbjct: 188 KKLLSLTKKLLSLT----KKLLSLTKKLLSLTKKLLSLTKK 224 Score = 28.7 bits (61), Expect = 5.1 Identities = 31/134 (23%), Positives = 57/134 (42%) Frame = +2 Query: 158 PVLIRPVLTQLEKYDLAASQTLRAALTKAEAAVPGLNYDLVAGIMRRADIPVNMNESLLR 337 P+ + L L K L+ ++ L +LTK ++ L ++ +++ + LL Sbjct: 436 PLSLTKKLLSLTKKPLSLTKKL-LSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLS 494 Query: 338 LQGSLTDSECTDLRLNRTEEAFQELNKKSAALKKILSRIPDEITDRKTFLETIKEIASAI 517 L L T L+ T++ K + KK+LS ++ K L K++ S Sbjct: 495 LTKKLLS--LTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLT 552 Query: 518 KKLLDAVNEVSTYT 559 KKLL ++ + T Sbjct: 553 KKLLSLTKKLLSLT 566 Score = 27.9 bits (59), Expect = 8.9 Identities = 35/142 (24%), Positives = 59/142 (41%), Gaps = 5/142 (3%) Frame = +2 Query: 230 ALTKAEAAVPGLNYDLVAGIMRRADIPVNMNESLLRLQG---SLTDS--ECTDLRLNRTE 394 +LTK ++ L ++ P+++ + LL L SLT T L+ T+ Sbjct: 410 SLTKKLLSLTKKLLSLTKKLLSLTKKPLSLTKKLLSLTKKPLSLTKKLLSLTKKLLSLTK 469 Query: 395 EAFQELNKKSAALKKILSRIPDEITDRKTFLETIKEIASAIKKLLDAVNEVSTYTPGPGK 574 + K + KK+LS ++ K L K++ S KKLL ++ + T K Sbjct: 470 KLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLT----K 525 Query: 575 QVLEQRKREFVKYSKRFSTTLK 640 ++L K+ K S T K Sbjct: 526 KLLSLTKKLLSLTKKLLSLTKK 547 Score = 27.9 bits (59), Expect = 8.9 Identities = 30/127 (23%), Positives = 54/127 (42%) Frame = +2 Query: 179 LTQLEKYDLAASQTLRAALTKAEAAVPGLNYDLVAGIMRRADIPVNMNESLLRLQGSLTD 358 L L K L+ ++ L +LTK ++ L ++ +++ + LL L L Sbjct: 429 LLSLTKKPLSLTKKL-LSLTKKPLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLS 487 Query: 359 SECTDLRLNRTEEAFQELNKKSAALKKILSRIPDEITDRKTFLETIKEIASAIKKLLDAV 538 T L+ T++ K + KK+LS ++ K L K++ S KKLL Sbjct: 488 --LTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLTKKLLSLT 545 Query: 539 NEVSTYT 559 ++ + T Sbjct: 546 KKLLSLT 552 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 30.3 bits (65), Expect = 1.7 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 4/65 (6%) Frame = +2 Query: 362 ECTDLRLNRTEEAFQELNKKSAAL----KKILSRIPDEITDRKTFLETIKEIASAIKKLL 529 E DL +N E E+N + L K++L E+TD K ++ ++ A ++K+L+ Sbjct: 1636 EKVDL-VNSLHEKMSEMNDEKDKLDDENKQLLDEKSREVTDLKGEVKKAQDDADSVKRLV 1694 Query: 530 DAVNE 544 DA+ E Sbjct: 1695 DAIIE 1699 >SB_32974| Best HMM Match : NblA (HMM E-Value=3.7) Length = 200 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +2 Query: 503 IASAIKKLLDAVNEVSTYTPGPGKQVLEQRKREFV--KYSKRFSTTLKE 643 + S+ +L A+NE+ TP P ++E+ RE ++SKR T+ + Sbjct: 4 LQSSEDELASAINELQELTPAPMVSMMERESREVALERHSKRQKMTITD 52 >SB_3044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 29.5 bits (63), Expect = 2.9 Identities = 17/76 (22%), Positives = 38/76 (50%) Frame = +2 Query: 371 DLRLNRTEEAFQELNKKSAALKKILSRIPDEITDRKTFLETIKEIASAIKKLLDAVNEVS 550 D LNR +E +++KK ++ +S PD ++++ ++++ + +K L E+ Sbjct: 637 DKELNRLKEELTQVSKKVSSAVSEMSDTPDNVSNQ------VEKVVNELKSLKKKHEELE 690 Query: 551 TYTPGPGKQVLEQRKR 598 + G ++ E KR Sbjct: 691 NSSKGAERRSKEAEKR 706 >SB_48325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 872 Score = 29.5 bits (63), Expect = 2.9 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +1 Query: 61 NHWGFINFLDKLKYLNYHNDNGR 129 NH +N DKLKYLN HN + R Sbjct: 61 NHRVKLNHRDKLKYLNKHNQDRR 83 >SB_15785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 600 Score = 29.5 bits (63), Expect = 2.9 Identities = 25/92 (27%), Positives = 45/92 (48%), Gaps = 1/92 (1%) Frame = +2 Query: 281 AGIMRRADIPVNMNESLLRLQGSLTDSECTDLRLNRTEEAFQELNKKSAALKKILSRIPD 460 A ++ + V ES L + + + SE + LR R +E Q L+ +KKI + + D Sbjct: 407 AAVINSLEAKVRDLESRLSQRSNTSASEVSSLRA-RVQELEQTLDDADEHIKKIETEL-D 464 Query: 461 EITDRKTFL-ETIKEIASAIKKLLDAVNEVST 553 ++ FL ET++ +L +A++E T Sbjct: 465 GSKEQMMFLQETVRRECEERLELTEALSEART 496 >SB_44978| Best HMM Match : REJ (HMM E-Value=3.9e-13) Length = 1819 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -1 Query: 606 TNSLFLCSNTCFPGPGVYVDTSFTASSNF 520 TN L +N FP PGV V ++TA N+ Sbjct: 581 TNKLTNVTNWAFPSPGVTVIHTYTAPGNY 609 >SB_30986| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 2682 Score = 28.7 bits (61), Expect = 5.1 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = -3 Query: 670 KYSLSFFKVFFESSRKSL*IFYKFSFPLF*YLLPRTWSICRYLIYSIQ*FFYGR-GYFLD 494 +Y + VF +R+S+ +YKFSF F Y +P I Y + + + R G F Sbjct: 188 RYGSKVYCVFNLETRRSIDTYYKFSFAFF-YAIPLAVVIVLYSAIMVTLWMHKRPGAFSS 246 Query: 493 SLKK 482 S ++ Sbjct: 247 SQQR 250 >SB_39349| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 1125 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/67 (26%), Positives = 31/67 (46%) Frame = -3 Query: 670 KYSLSFFKVFFESSRKSL*IFYKFSFPLF*YLLPRTWSICRYLIYSIQ*FFYGRGYFLDS 491 +Y + VF +R+S+ +YKFSF F Y +P I Y + + + R S Sbjct: 931 RYGSKVYCVFNLETRRSIDTYYKFSFAFF-YAIPLAVVIVLYSAIMVTLWMHKRPGAFSS 989 Query: 490 LKKSLPI 470 +++ I Sbjct: 990 IQQRYQI 996 >SB_36821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1503 Score = 28.7 bits (61), Expect = 5.1 Identities = 29/122 (23%), Positives = 52/122 (42%), Gaps = 1/122 (0%) Frame = +2 Query: 179 LTQLEKYDLAASQTLRAALTKAEAAVPGLNYDLVAGIMRRADIPVNMNESLLRLQGSLTD 358 LTQ + + +A +T++A + + L I RR + L L+ ++ + Sbjct: 472 LTQSKLHGIAPGRTMQAVTNEYNDRQDRVE-TLNRHIDRRRREVTQLQRQLSTLENTINE 530 Query: 359 SECTDLRLNRTEEAFQELNKKSAALKKILSRIPDEITDRKTFLETIK-EIASAIKKLLDA 535 LRL+ + L ++ A L + EITD + L+ I+ E+ KK + Sbjct: 531 LRSQKLRLSEQLQRRTNLEEQKAELIANSNTYEREITDAEAQLKPIESELREEEKKKAEI 590 Query: 536 VN 541 VN Sbjct: 591 VN 592 >SB_8196| Best HMM Match : NGP1NT (HMM E-Value=0.89) Length = 374 Score = 28.7 bits (61), Expect = 5.1 Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Frame = +2 Query: 329 LLRLQGSLTDSECTDLRLNRTEEAFQELNKKSAALKKILSRIPDE-ITDRKTFLETIKEI 505 LL G+ + T + + R E Q LN+ S+ + L +IP + + + + +++E+ Sbjct: 298 LLSADGATLIKDKTAINMRRREHFSQLLNRPSSVDQSALDQIPQQLLIEELSDPPSMEEL 357 Query: 506 ASAIKKL 526 AIK++ Sbjct: 358 TKAIKQM 364 >SB_47201| Best HMM Match : SAM_1 (HMM E-Value=7.1e-09) Length = 765 Score = 28.3 bits (60), Expect = 6.7 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 7/97 (7%) Frame = +2 Query: 302 DIPVNMNESLLRLQGSLTDSECTDLRLNRTEEAFQELNKKSAALKKIL--SRIPDEITD- 472 D+P+ + L GSL + LN ++E + A KIL +R E +D Sbjct: 252 DVPMWLKSLRLHKYGSLFSQLSYEEMLNLSDEYLESKGVTKGARNKILLSTRKLQERSDT 311 Query: 473 -RKTFLETIK--EIASAIKKLLDAVN-EVSTYTPGPG 571 +K E ++ ++ + +K+L VN + +TP PG Sbjct: 312 LQKLEKEVLQNGKLQAVLKELQQIVNTPIKPFTPSPG 348 >SB_4186| Best HMM Match : ADK (HMM E-Value=0.094) Length = 1053 Score = 28.3 bits (60), Expect = 6.7 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 310 RNICSPHDSCHQIIIKTRYCSLCFGES 230 RN+ P +CH++ ++RY S+ G S Sbjct: 463 RNVSVPSSNCHELATESRYKSVWMGAS 489 >SB_59414| Best HMM Match : Complex1_LYR (HMM E-Value=7.7) Length = 350 Score = 27.9 bits (59), Expect = 8.9 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +2 Query: 401 FQELNKKSAALKKILSRIPDEITDRKTFLETIKEIASAIKKLL 529 ++E+ K K ILS DE + RK+FL+T ++SA LL Sbjct: 71 YKEIFKAFPDAKVILSVRDDEESWRKSFLKTESIVSSATSNLL 113 >SB_54637| Best HMM Match : DUF1621 (HMM E-Value=3) Length = 265 Score = 27.9 bits (59), Expect = 8.9 Identities = 21/68 (30%), Positives = 26/68 (38%) Frame = +2 Query: 299 ADIPVNMNESLLRLQGSLTDSECTDLRLNRTEEAFQELNKKSAALKKILSRIPDEITDRK 478 A+I + N L GSL DS C L + KK A L + + D K Sbjct: 73 AEIVDDKNRGLFGRLGSLGDSPCARAHLLYCVHDIKLAKKKDAVLVSCENHKINRNKDHK 132 Query: 479 TFLETIKE 502 F E KE Sbjct: 133 AFTEGCKE 140 >SB_10566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1264 Score = 27.9 bits (59), Expect = 8.9 Identities = 17/83 (20%), Positives = 40/83 (48%) Frame = +2 Query: 317 MNESLLRLQGSLTDSECTDLRLNRTEEAFQELNKKSAALKKILSRIPDEITDRKTFLETI 496 ++E+ +Q + D + T + T+ E NK+ KK + + ++++ + ++ Sbjct: 227 VDETKREVQETKKDVQETKKEVQETKTKVDETNKEVQETKKEVHEVKGKVSEMAVDVASL 286 Query: 497 KEIASAIKKLLDAVNEVSTYTPG 565 KE S ++ +D ++ YT G Sbjct: 287 KEEFSTVQDFIDYLH--LRYTTG 307 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 27.9 bits (59), Expect = 8.9 Identities = 32/129 (24%), Positives = 59/129 (45%), Gaps = 4/129 (3%) Frame = +2 Query: 167 IRPVLTQLEKYDLAASQTLRAALTK---AEAAVPGLNYDLVAGIMRRADIPVNMNESLLR 337 ++ + QLE A +R TK E ++ DL+ R AD + ++ Sbjct: 552 LKNTIAQLEDKINALDNDVREVNTKNDILEDQAKEMHDDLLEANKRAADAEDELQQTEDE 611 Query: 338 LQGSLTDSECTDLRLNRTEEAFQELNKKSAAL-KKILSRIPDEITDRKTFLETIKEIASA 514 L D + + R++ E AF +K+ L +++LS+ P +I ++ L+ ASA Sbjct: 612 LNRLKNDIQEKEKRISELESAFDAADKEKRDLEQQVLSQTP-KIKRLESELQDALNRASA 670 Query: 515 IKKLLDAVN 541 +++ DA N Sbjct: 671 LEE--DAKN 677 >SB_45927| Best HMM Match : WD40 (HMM E-Value=9e-18) Length = 1764 Score = 27.9 bits (59), Expect = 8.9 Identities = 28/105 (26%), Positives = 51/105 (48%), Gaps = 3/105 (2%) Frame = +2 Query: 392 EEAFQELNKKS--AALKKIL-SRIPDEITDRKTFLETIKEIASAIKKLLDAVNEVSTYTP 562 + F +L+ S +AL + + + I DEITDR + L+ +K S++K++L +N + Y Sbjct: 359 QREFTDLDPASGGSALSRYMDTTIGDEITDRMSMLQQLK---SSMKQIL-GINNMLVYKI 414 Query: 563 GPGKQVLEQRKREFVKYSKRFSTTLKEYFKEGQ*VFMSISYNLRS 697 K+ ++ E +Y F + + + SIS N S Sbjct: 415 KWTKKGIDPTNDEHRQYLNTFCRDFQRVLETK--ITQSISENTSS 457 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,595,272 Number of Sequences: 59808 Number of extensions: 411665 Number of successful extensions: 1063 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1006 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -