BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30766 (639 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g16563.1 68417.m02506 aspartyl protease family protein contai... 28 6.0 At3g24340.1 68416.m03056 SNF2 domain-containing protein / helica... 28 6.0 >At4g16563.1 68417.m02506 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 499 Score = 27.9 bits (59), Expect = 6.0 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 454 PSKKNFNTSSVSCATPSCRIRHEDL 380 PS + + ++VSC++PSC H L Sbjct: 129 PSSLSSSATTVSCSSPSCSAAHSSL 153 >At3g24340.1 68416.m03056 SNF2 domain-containing protein / helicase domain-containing protein similar to SP|P41410 DNA repair protein rhp54 (RAD54 homolog) {Schizosaccharomyces pombe}; contains PFam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 1132 Score = 27.9 bits (59), Expect = 6.0 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = -2 Query: 134 KRTASR-DSFLNSLLNSAQMTNSCNEDQVFG 45 +RT SR +S+LNS+LN ++ + EDQ G Sbjct: 9 RRTRSRTESYLNSILNKSKGISGEEEDQSLG 39 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,259,511 Number of Sequences: 28952 Number of extensions: 213653 Number of successful extensions: 472 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 472 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1314848736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -