BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30762 (727 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264333-1|BAF44088.1| 36|Apis mellifera ecdysone-induced prot... 23 3.9 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 6.8 >AB264333-1|BAF44088.1| 36|Apis mellifera ecdysone-induced protein 75 protein. Length = 36 Score = 22.6 bits (46), Expect = 3.9 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +3 Query: 219 YYSSLPSHIKVNLPALSPTMES 284 + + LP H+ N+P + T+ S Sbjct: 6 HVAQLPHHLSPNMPTMDSTVSS 27 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.8 bits (44), Expect = 6.8 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 469 LEIRMMLRHSKISKMTHHLQHLKNRLVKIKRLAAPAP 579 LEI++ +++ M HHL H+ K++A+P P Sbjct: 326 LEIQLQKERDRLTAMMHHL-HV------AKQMASPEP 355 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,025 Number of Sequences: 438 Number of extensions: 3741 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -