BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30757 (596 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g45000.1 68416.m04848 SNF7 family protein contains Pfam profi... 32 0.25 At5g22950.1 68418.m02683 SNF7 family protein contains Pfam domai... 30 1.3 At5g46340.1 68418.m05704 O-acetyltransferase-related similar to ... 27 7.2 At3g56270.1 68416.m06253 expressed protein contains Pfam PF05701... 27 7.2 At3g56410.2 68416.m06274 expressed protein 27 9.5 At3g56410.1 68416.m06273 expressed protein 27 9.5 At1g29890.1 68414.m03653 acetyltransferase-related low similarit... 27 9.5 >At3g45000.1 68416.m04848 SNF7 family protein contains Pfam profile PF03357: SNF7 family Length = 200 Score = 32.3 bits (70), Expect = 0.25 Identities = 15/67 (22%), Positives = 36/67 (53%) Frame = -3 Query: 561 KAVRERIRRNPVRKQKILSREMKIAPRTMSRILKDDLGLAAYKRRTGHFLTDNLKENRVV 382 KA+++ ++RN + K L+RE+ + RT+ R+ ++ + + G + + + Sbjct: 19 KAIKDSVKRNDLVTAKALAREIVSSRRTVKRLYENKAQVNSISMHLGESIATAVTVGNLS 78 Query: 381 KSKQLLK 361 KS +++K Sbjct: 79 KSGEVMK 85 >At5g22950.1 68418.m02683 SNF7 family protein contains Pfam domain, PF03357: SNF7 family Length = 229 Score = 29.9 bits (64), Expect = 1.3 Identities = 15/67 (22%), Positives = 35/67 (52%) Frame = -3 Query: 561 KAVRERIRRNPVRKQKILSREMKIAPRTMSRILKDDLGLAAYKRRTGHFLTDNLKENRVV 382 KA++E +RN + K L++E+ + RT++R+ ++ + + G + + Sbjct: 48 KAIKEAAKRNDMVSAKALAKEIVSSRRTVNRLYENKAQMNSISMHLGESVAIARTVGHLS 107 Query: 381 KSKQLLK 361 KS +++K Sbjct: 108 KSAEVMK 114 >At5g46340.1 68418.m05704 O-acetyltransferase-related similar to O-acetyltransferase [Homo sapiens] GI:17016934 Length = 540 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = +3 Query: 369 VVSILPPYSLLNYQLRNDQY--VSYRLQVLSHLLK 467 ++SI+P Y +LN+ L Y VS+RL L++ LK Sbjct: 468 LLSIIPGYPMLNFMLTTAIYVLVSHRLFELTNTLK 502 >At3g56270.1 68416.m06253 expressed protein contains Pfam PF05701: Plant protein of unknown function (DUF827) Length = 446 Score = 27.5 bits (58), Expect = 7.2 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -3 Query: 579 VRKRWSKAVRERIRRNPVRKQKILSREMKIAPRTMSRILKDDLGL 445 +R + V E RNP++ +++ EMK A + + + DDL L Sbjct: 131 LRSHSKEMVDEHCHRNPLKSPDLMTMEMKQAGMNLCKTM-DDLAL 174 >At3g56410.2 68416.m06274 expressed protein Length = 1535 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/69 (21%), Positives = 34/69 (49%), Gaps = 6/69 (8%) Frame = -3 Query: 387 VVKSKQLLKRY----VKGGHRNFL--FTDVKMFTIEQHFKKQNDRIYAQSSKEASQLVDR 226 V+ S+++L+ + +K RN F D+K+ ++ H K +R ++ +S+ + Sbjct: 485 VILSQKILETFEDKGIKEDIRNISTKFLDLKLEALQPHLKPMGNRRLSEQQPTSSETIGE 544 Query: 225 VQRVHYPTS 199 ++H S Sbjct: 545 TSKIHLEQS 553 >At3g56410.1 68416.m06273 expressed protein Length = 1488 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/69 (21%), Positives = 34/69 (49%), Gaps = 6/69 (8%) Frame = -3 Query: 387 VVKSKQLLKRY----VKGGHRNFL--FTDVKMFTIEQHFKKQNDRIYAQSSKEASQLVDR 226 V+ S+++L+ + +K RN F D+K+ ++ H K +R ++ +S+ + Sbjct: 438 VILSQKILETFEDKGIKEDIRNISTKFLDLKLEALQPHLKPMGNRRLSEQQPTSSETIGE 497 Query: 225 VQRVHYPTS 199 ++H S Sbjct: 498 TSKIHLEQS 506 >At1g29890.1 68414.m03653 acetyltransferase-related low similarity to O-acetyltransferase [Cryptococcus neoformans var. neoformans] GI:17063556 Length = 470 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = +3 Query: 366 VVVSILPPYSLLNYQLRNDQY--VSYRLQVLSHLLK 467 +++SI+P Y +LN+ L Y VS RL L++ LK Sbjct: 397 LLLSIIPEYPMLNFMLTTAIYVLVSVRLFELTNTLK 432 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,434,387 Number of Sequences: 28952 Number of extensions: 243915 Number of successful extensions: 580 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 580 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -