BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30755 (506 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0645 - 19562886-19564484 30 0.93 12_02_0428 - 18980002-18980075,18980201-18980434,18980508-189805... 27 8.7 >10_08_0645 - 19562886-19564484 Length = 532 Score = 30.3 bits (65), Expect = 0.93 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +2 Query: 44 HTAHPMVIGYRRPWTSAMPGAEPSLVSTRTVTGVKTHYAT 163 HTAH +G R WT+A P + R V V+ H T Sbjct: 115 HTAHDAFLGARLAWTNAGPAGDGGGGRERLVLRVRRHDRT 154 >12_02_0428 - 18980002-18980075,18980201-18980434,18980508-18980594, 18981843-18981907,18982132-18982220,18982291-18982636, 18984011-18984019,18984378-18984544 Length = 356 Score = 27.1 bits (57), Expect = 8.7 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 155 YATLNFAHATLLNFLLVVGPLVSPH 229 +A NF+ TL +FLL PL+ PH Sbjct: 112 FALKNFSLTTLRSFLLYYLPLLEPH 136 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,705,107 Number of Sequences: 37544 Number of extensions: 268239 Number of successful extensions: 677 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 663 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 677 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1083123860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -