BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30755 (506 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM079132-1|CAL03278.1| 100|Homo sapiens immunoglobulin heavy ch... 33 0.76 AM079932-1|CAL04078.1| 101|Homo sapiens immunoglobulin heavy ch... 30 4.0 AJ555926-1|CAD88647.1| 115|Homo sapiens immunoglobulin heavy ch... 30 4.0 AJ627949-1|CAF31295.1| 123|Homo sapiens immunoglobulin heavy ch... 30 5.3 AY941899-1|AAY33248.1| 122|Homo sapiens anti-rabies virus immun... 29 9.3 >AM079132-1|CAL03278.1| 100|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 100 Score = 32.7 bits (71), Expect = 0.76 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +2 Query: 71 YRRPWTSAMPGAEPSLVSTRTVTGVKTHYA 160 Y W PG P VST + GV THYA Sbjct: 35 YAMTWVRQAPGKGPEWVSTTSGNGVSTHYA 64 >AM079932-1|CAL04078.1| 101|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 101 Score = 30.3 bits (65), Expect = 4.0 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +2 Query: 71 YRRPWTSAMPGAEPSLVSTRTVTGVKTHYA 160 Y W PG P LVST + G T+YA Sbjct: 35 YAMSWVRQAPGKGPELVSTISGNGASTYYA 64 >AJ555926-1|CAD88647.1| 115|Homo sapiens immunoglobulin heavy chain protein. Length = 115 Score = 30.3 bits (65), Expect = 4.0 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 71 YRRPWTSAMPGAEPSLVSTRTVTGVKTHYA 160 Y W PG P VST + +GV T+YA Sbjct: 32 YVMSWVRQAPGKGPEWVSTISASGVNTYYA 61 >AJ627949-1|CAF31295.1| 123|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 123 Score = 29.9 bits (64), Expect = 5.3 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 71 YRRPWTSAMPGAEPSLVSTRTVTGVKTHYA 160 Y W PG P VST + +GV T+YA Sbjct: 32 YAMSWVRQAPGKGPEWVSTISGSGVSTYYA 61 >AY941899-1|AAY33248.1| 122|Homo sapiens anti-rabies virus immunoglobulin heavy chain variable region protein. Length = 122 Score = 29.1 bits (62), Expect = 9.3 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 71 YRRPWTSAMPGAEPSLVSTRTVTGVKTHYA 160 Y W PG P V++ + +GV THYA Sbjct: 32 YAMSWVRQAPGKGPEWVASISGSGVTTHYA 61 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,518,314 Number of Sequences: 237096 Number of extensions: 1519932 Number of successful extensions: 7162 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7162 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4706589866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -