BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30755 (506 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66567-2|CAA91488.1| 1118|Caenorhabditis elegans Hypothetical pr... 30 0.84 AL033508-1|CAA22058.2| 821|Caenorhabditis elegans Hypothetical ... 28 4.5 >Z66567-2|CAA91488.1| 1118|Caenorhabditis elegans Hypothetical protein ZK455.2 protein. Length = 1118 Score = 30.3 bits (65), Expect = 0.84 Identities = 23/59 (38%), Positives = 27/59 (45%) Frame = +2 Query: 41 EHTAHPMVIGYRRPWTSAMPGAEPSLVSTRTVTGVKTHYATLNFAHATLLNFLLVVGPL 217 EH AH + Y W S G P V TG + Y F A+LL F+L VGPL Sbjct: 454 EHVAHETIQYY---WPSDS-GKLPPAVPKCGFTGAECDYRPY-FIGASLLAFILTVGPL 507 >AL033508-1|CAA22058.2| 821|Caenorhabditis elegans Hypothetical protein Y106G6G.2 protein. Length = 821 Score = 27.9 bits (59), Expect = 4.5 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 324 LELTYISRWVTHLHCRCLWVSLLVEPFVAND 416 L +T I W + L C+C V+LLVE +N+ Sbjct: 96 LAMTGIDEWKSQLQCKC--VTLLVEMVCSNE 124 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,377,184 Number of Sequences: 27780 Number of extensions: 219276 Number of successful extensions: 409 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 409 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 977860456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -