BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30753 (304 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 24 1.1 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 22 5.9 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 21 7.8 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 24.2 bits (50), Expect = 1.1 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +2 Query: 89 STFALAVAGGTFFFERTFELVSQSIFENLNKGKLW 193 +T+A+ + G T E +L+ SI +N K + W Sbjct: 1030 ATYAMMLNGHTMKKEALDKLIDMSISDNNKKERYW 1064 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +2 Query: 5 ERTSLEFFEKIFKMSLWSTLNRTVFKRTST 94 +R FEK M+ W T ++K+ +T Sbjct: 798 DRREFARFEKERMMAKWDTGENPIYKQATT 827 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 109 NSQSKRRCTFENSTI*CR 56 N+ S CT EN + CR Sbjct: 171 NTSSADNCTTENDEVICR 188 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 239,114 Number of Sequences: 2352 Number of extensions: 2864 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 19557855 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -