BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30751 (624 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC28F2.11 |||INO80 complex subunit |Schizosaccharomyces pombe|... 27 2.9 SPBC36.06c |spo9||farnesyl pyrophosphate synthetase|Schizosaccha... 26 5.1 SPBC409.07c |wis1|spc2, smf2|MAP kinase kinase Wis1|Schizosaccha... 25 8.9 >SPBC28F2.11 |||INO80 complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 310 Score = 26.6 bits (56), Expect = 2.9 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = +1 Query: 16 STTNVQTSHETKLMKRQRGESEAFSAEHISPITLPLGTPDWRSSAPRPPA 165 +T +++ H K KR+ S ++ P++ P +PD S+P PP+ Sbjct: 236 ATPDIKEQHAKK-PKRKHTRSTV-PTSNVEPVSQPQPSPDKIVSSPNPPS 283 >SPBC36.06c |spo9||farnesyl pyrophosphate synthetase|Schizosaccharomyces pombe|chr 2|||Manual Length = 351 Score = 25.8 bits (54), Expect = 5.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 192 PPRWRRLEWSILRNTPLGQNQRGLRI 269 P +L +SI RNT G+N RGL + Sbjct: 37 PEETEKLLYSIKRNTLGGKNNRGLAV 62 >SPBC409.07c |wis1|spc2, smf2|MAP kinase kinase Wis1|Schizosaccharomyces pombe|chr 2|||Manual Length = 605 Score = 25.0 bits (52), Expect = 8.9 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = -1 Query: 426 RRISPKPWPSKCFGSPHMSAWGPAKGA*EDDVQAALHAFYA-RAMSIRVMEGRLSS 262 RR P GSP GP G D+Q L AF+A R+ S+ + ++SS Sbjct: 115 RRSLPTAAGQNNIGSPPTPP-GPFPGGLSTDIQEKLKAFHASRSKSMPEVVNKISS 169 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,463,438 Number of Sequences: 5004 Number of extensions: 46308 Number of successful extensions: 107 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 275671126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -