BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30751 (624 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. 24 1.4 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 5.6 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 5.6 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 9.8 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 9.8 >AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. Length = 147 Score = 23.8 bits (49), Expect = 1.4 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Frame = +1 Query: 10 CLSTTN-VQTSHETKLMKRQRGESEAFS--AEHISPITLPLGTPDWRSSAPRPP 162 C T N Q + +KR + + AE + P LP G + SS P+PP Sbjct: 9 CKITANRQQVMRQNMKLKRHLAQDKVKVRVAEEVDP--LPFGVENTISSVPQPP 60 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.8 bits (44), Expect = 5.6 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 73 ESEAFSAEHISPITLPLGTPDWR 141 +S F + I+ LPLG WR Sbjct: 174 DSAIFDGDFITENNLPLGLEVWR 196 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 5.6 Identities = 9/24 (37%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = +3 Query: 468 TRPAASFCEMVH-SQKSSIAFHDS 536 T SFCEM+H +Q + + H++ Sbjct: 566 TAATLSFCEMIHNAQVNKRSIHNN 589 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = +1 Query: 307 IKRVQSSLHVVFLGPLRRSPGRHVRGPE 390 ++ QS LH+ P RSP + + Sbjct: 664 VQHTQSQLHLHLTSPPARSPSSQAQASQ 691 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.0 bits (42), Expect = 9.8 Identities = 6/19 (31%), Positives = 13/19 (68%) Frame = +1 Query: 274 AFHHPDAHCSCIKRVQSSL 330 ++H P+AH S +++Q + Sbjct: 155 SWHSPEAHISVAQKLQKEI 173 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,969 Number of Sequences: 438 Number of extensions: 4048 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18582456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -