BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30740 (744 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylch... 25 1.9 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 25 3.3 AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding pr... 25 3.3 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 23 7.5 >AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 8 protein. Length = 520 Score = 25.4 bits (53), Expect = 1.9 Identities = 13/50 (26%), Positives = 23/50 (46%) Frame = -2 Query: 659 IELSILIRCILHYGSAPRRSGHGQRVQSAVSLYSSSWNDCNFCSSKVI*N 510 + +++ C++ SA RS HG+ A LY ++ N V+ N Sbjct: 2 LNAKVILLCLVASSSAQGRSSHGRANPDAKRLYDDLLSNYNRLIRPVVNN 51 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 24.6 bits (51), Expect = 3.3 Identities = 16/48 (33%), Positives = 20/48 (41%) Frame = +3 Query: 174 VVTSIVQLTLPSQAPSAQVQSVIQPNQQSVIQTASNIQSVQIPKGNVI 317 +VT+ + L P QSVI S Q SNI V + G I Sbjct: 20 LVTATILPILSLMVPIGHSQSVITDCDTSKCQPLSNISEVSLEPGQRI 67 >AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding protein 1 protein. Length = 304 Score = 24.6 bits (51), Expect = 3.3 Identities = 11/35 (31%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +3 Query: 306 GNVILVSK--PSSVIHTTQGTLQTLQIKPEPNTLV 404 GN++ + P++ +H TQ L L + P P L+ Sbjct: 139 GNLVTCPQYVPATKLHATQAALDCLTVLPVPTDLL 173 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.4 bits (48), Expect = 7.5 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 Query: 405 NTQGQSCSDESCGSGDESPKRKY 473 N +SCS C S E+P R + Sbjct: 120 NDDQESCSSNECVSTTETPTRHF 142 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 696,127 Number of Sequences: 2352 Number of extensions: 11747 Number of successful extensions: 25 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -