SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= maV30739
         (768 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate r...    24   1.4  
Y13429-1|CAA73841.1|  402|Apis mellifera dopamine receptor, D1 p...    21   9.5  
DQ435333-1|ABD92648.1|  135|Apis mellifera OBP16 protein.              21   9.5  

>AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate
           receptor 1 protein.
          Length = 953

 Score = 24.2 bits (50), Expect = 1.4
 Identities = 17/66 (25%), Positives = 30/66 (45%)
 Frame = +1

Query: 385 LMNPSATDSRGAYLIDRSPEYFEPILNYLRHGEVIIDKYVNPRGVLEEAVFYGIDSMIPH 564
           L NP+     G +  ++S +YFE  LN L      ++K V  +  + E     I + +  
Sbjct: 28  LNNPTLFMIGGVFSNNKSKKYFEQTLNELNFNLNYVNKGVTYKHTIIEMDSNPIKTALSV 87

Query: 565 IQKIIE 582
            + +IE
Sbjct: 88  CKSLIE 93


>Y13429-1|CAA73841.1|  402|Apis mellifera dopamine receptor, D1
           protein.
          Length = 402

 Score = 21.4 bits (43), Expect = 9.5
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -1

Query: 429 Y*VCSPRVCGTWV 391
           Y V  PR C TW+
Sbjct: 90  YWVFGPRFCDTWI 102


>DQ435333-1|ABD92648.1|  135|Apis mellifera OBP16 protein.
          Length = 135

 Score = 21.4 bits (43), Expect = 9.5
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 627 CCPSSDKNIHI 659
           C P SD N+HI
Sbjct: 104 CSPISDANVHI 114


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 199,977
Number of Sequences: 438
Number of extensions: 3820
Number of successful extensions: 5
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24032646
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -