BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30739 (768 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 24 1.4 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 9.5 DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 21 9.5 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 24.2 bits (50), Expect = 1.4 Identities = 17/66 (25%), Positives = 30/66 (45%) Frame = +1 Query: 385 LMNPSATDSRGAYLIDRSPEYFEPILNYLRHGEVIIDKYVNPRGVLEEAVFYGIDSMIPH 564 L NP+ G + ++S +YFE LN L ++K V + + E I + + Sbjct: 28 LNNPTLFMIGGVFSNNKSKKYFEQTLNELNFNLNYVNKGVTYKHTIIEMDSNPIKTALSV 87 Query: 565 IQKIIE 582 + +IE Sbjct: 88 CKSLIE 93 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -1 Query: 429 Y*VCSPRVCGTWV 391 Y V PR C TW+ Sbjct: 90 YWVFGPRFCDTWI 102 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 627 CCPSSDKNIHI 659 C P SD N+HI Sbjct: 104 CSPISDANVHI 114 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,977 Number of Sequences: 438 Number of extensions: 3820 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -