BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30737 (760 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 28 0.27 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 27 0.48 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 25 1.9 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 3.3 EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. 24 5.9 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 28.3 bits (60), Expect = 0.27 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 487 VSWRYLKQKFQPAKNRVKQYPNDLTHHNPH 576 V W L Q+ QP+ +Q+P HH+ H Sbjct: 158 VPWYQLPQQQQPSSYHQQQHPGHSQHHHHH 187 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 27.5 bits (58), Expect = 0.48 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = +3 Query: 516 PASQEPREAVP**LDASQPSCRSAETETRTQARNTKPGSPKTNEPTSQREGL 671 P+ + PR P PSCRS R ++R+T+P S + PTS+ + L Sbjct: 252 PSRRNPRRRSPR-SGGRWPSCRSPPA--RRRSRSTRPTSWPRSRPTSKPKRL 300 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.4 bits (53), Expect = 1.9 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 238 PETNRCAPCNVVCNKT 285 P+ + C PC VC KT Sbjct: 286 PQNSECVPCKGVCPKT 301 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 24.6 bits (51), Expect = 3.3 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -2 Query: 312 AKAAIVVMVCFIADNIARSASVGLRGAVFV*LTYQLTAS 196 A I + F+A + +A+VG+ A V Y TAS Sbjct: 2736 APVGIAGSITFLAGAVGTTAAVGITAATSVGFAYVSTAS 2774 >EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. Length = 481 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 646 NQPLNVKDLETRTSQSDKSQGAT 714 N+PL V+D+ RT S QG T Sbjct: 406 NEPLVVRDVSQRTFISVDEQGTT 428 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 771,078 Number of Sequences: 2352 Number of extensions: 15208 Number of successful extensions: 31 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -