BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30736 (743 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 26 1.4 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 7.5 AY752901-1|AAV30075.1| 90|Anopheles gambiae peroxidase 7 protein. 23 10.0 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 23 10.0 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 25.8 bits (54), Expect = 1.4 Identities = 11/34 (32%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -1 Query: 464 PPILAEAHRFAPN-FIFPSVQVILMHSPVKTLYH 366 PPI+ +A F PN F ++ IL+ + + T+++ Sbjct: 312 PPIILDAGYFMPNRMFFDNIGTILLMAVIGTIFN 345 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.4 bits (48), Expect = 7.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 642 WRCVSQACLL*PYNSMVCE 586 +R +S+AC PYN+ CE Sbjct: 311 YRTLSKACYNCPYNATDCE 329 >AY752901-1|AAV30075.1| 90|Anopheles gambiae peroxidase 7 protein. Length = 90 Score = 23.0 bits (47), Expect = 10.0 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -3 Query: 93 YEHLFYYNWL 64 Y+H+ YY WL Sbjct: 28 YQHIVYYEWL 37 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 23.0 bits (47), Expect = 10.0 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 5/34 (14%) Frame = -1 Query: 629 RRLVCYDRTTQWCVRQ-----HDQEHLDISVLTH 543 +++VCY T W V + +D EH+D S+ TH Sbjct: 31 KKVVCYVGT--WAVYRPGNGRYDIEHIDPSLCTH 62 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 761,079 Number of Sequences: 2352 Number of extensions: 15264 Number of successful extensions: 36 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -