BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30736 (743 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ314877-1|ABC40736.1| 693|Homo sapiens mitogen-activated prote... 34 0.62 CR457387-1|CAG33668.1| 536|Homo sapiens MAP3K7IP2 protein. 34 0.62 BC035910-1|AAH35910.1| 693|Homo sapiens mitogen-activated prote... 34 0.62 BC032526-1|AAH32526.1| 712|Homo sapiens mitogen-activated prote... 34 0.62 AY437560-1|AAR06179.1| 712|Homo sapiens TAK1-binding protein 3 ... 34 0.62 AY371491-1|AAQ88279.1| 712|Homo sapiens TAK1 binding protein 3 ... 34 0.62 AY331592-1|AAQ92939.1| 684|Homo sapiens NFkB activating protein... 34 0.62 AY331591-1|AAQ92938.1| 712|Homo sapiens NFkB activating protein... 34 0.62 AL139103-1|CAI20971.1| 693|Homo sapiens mitogen-activated prote... 34 0.62 AL138727-1|CAI19581.1| 693|Homo sapiens mitogen-activated prote... 34 0.62 AL031133-2|CAI20026.1| 693|Homo sapiens mitogen-activated prote... 34 0.62 AF241230-1|AAF67176.1| 693|Homo sapiens TAK1-binding protein 2 ... 34 0.62 AB018276-1|BAA34453.2| 698|Homo sapiens KIAA0733 protein protein. 34 0.62 >DQ314877-1|ABC40736.1| 693|Homo sapiens mitogen-activated protein kinase kinase kinase 7 interacting protein 2 protein. Length = 693 Score = 33.9 bits (74), Expect = 0.62 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +2 Query: 533 QLFHELKQKYPGVPDHVVSHTIELYGHNKQACETHLHSE 649 Q+ H+L+QK+P VP+ VVS + +N AC L E Sbjct: 11 QVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQE 49 >CR457387-1|CAG33668.1| 536|Homo sapiens MAP3K7IP2 protein. Length = 536 Score = 33.9 bits (74), Expect = 0.62 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +2 Query: 533 QLFHELKQKYPGVPDHVVSHTIELYGHNKQACETHLHSE 649 Q+ H+L+QK+P VP+ VVS + +N AC L E Sbjct: 11 QVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQE 49 >BC035910-1|AAH35910.1| 693|Homo sapiens mitogen-activated protein kinase kinase kinase 7 interacting protein 2 protein. Length = 693 Score = 33.9 bits (74), Expect = 0.62 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +2 Query: 533 QLFHELKQKYPGVPDHVVSHTIELYGHNKQACETHLHSE 649 Q+ H+L+QK+P VP+ VVS + +N AC L E Sbjct: 11 QVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQE 49 >BC032526-1|AAH32526.1| 712|Homo sapiens mitogen-activated protein kinase kinase kinase 7 interacting protein 3 protein. Length = 712 Score = 33.9 bits (74), Expect = 0.62 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = +2 Query: 530 MQLFHELKQKYPGVPDHVVSHTIELYGHNKQACETHLHSE 649 +Q+ H+L+Q++P +P+ VVS + +N +AC L E Sbjct: 10 IQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQE 49 >AY437560-1|AAR06179.1| 712|Homo sapiens TAK1-binding protein 3 protein. Length = 712 Score = 33.9 bits (74), Expect = 0.62 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = +2 Query: 530 MQLFHELKQKYPGVPDHVVSHTIELYGHNKQACETHLHSE 649 +Q+ H+L+Q++P +P+ VVS + +N +AC L E Sbjct: 10 IQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQE 49 >AY371491-1|AAQ88279.1| 712|Homo sapiens TAK1 binding protein 3 protein. Length = 712 Score = 33.9 bits (74), Expect = 0.62 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = +2 Query: 530 MQLFHELKQKYPGVPDHVVSHTIELYGHNKQACETHLHSE 649 +Q+ H+L+Q++P +P+ VVS + +N +AC L E Sbjct: 10 IQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQE 49 >AY331592-1|AAQ92939.1| 684|Homo sapiens NFkB activating protein 1 isoform B protein. Length = 684 Score = 33.9 bits (74), Expect = 0.62 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = +2 Query: 530 MQLFHELKQKYPGVPDHVVSHTIELYGHNKQACETHLHSE 649 +Q+ H+L+Q++P +P+ VVS + +N +AC L E Sbjct: 10 IQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQE 49 >AY331591-1|AAQ92938.1| 712|Homo sapiens NFkB activating protein 1 isoform A protein. Length = 712 Score = 33.9 bits (74), Expect = 0.62 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = +2 Query: 530 MQLFHELKQKYPGVPDHVVSHTIELYGHNKQACETHLHSE 649 +Q+ H+L+Q++P +P+ VVS + +N +AC L E Sbjct: 10 IQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQE 49 >AL139103-1|CAI20971.1| 693|Homo sapiens mitogen-activated protein kinase kinase kinase 7 interacting protein 2 protein. Length = 693 Score = 33.9 bits (74), Expect = 0.62 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +2 Query: 533 QLFHELKQKYPGVPDHVVSHTIELYGHNKQACETHLHSE 649 Q+ H+L+QK+P VP+ VVS + +N AC L E Sbjct: 11 QVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQE 49 >AL138727-1|CAI19581.1| 693|Homo sapiens mitogen-activated protein kinase kinase kinase 7 interacting protein 2 protein. Length = 693 Score = 33.9 bits (74), Expect = 0.62 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +2 Query: 533 QLFHELKQKYPGVPDHVVSHTIELYGHNKQACETHLHSE 649 Q+ H+L+QK+P VP+ VVS + +N AC L E Sbjct: 11 QVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQE 49 >AL031133-2|CAI20026.1| 693|Homo sapiens mitogen-activated protein kinase kinase kinase 7 interacting protein 2 protein. Length = 693 Score = 33.9 bits (74), Expect = 0.62 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +2 Query: 533 QLFHELKQKYPGVPDHVVSHTIELYGHNKQACETHLHSE 649 Q+ H+L+QK+P VP+ VVS + +N AC L E Sbjct: 11 QVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQE 49 >AF241230-1|AAF67176.1| 693|Homo sapiens TAK1-binding protein 2 protein. Length = 693 Score = 33.9 bits (74), Expect = 0.62 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +2 Query: 533 QLFHELKQKYPGVPDHVVSHTIELYGHNKQACETHLHSE 649 Q+ H+L+QK+P VP+ VVS + +N AC L E Sbjct: 11 QVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQE 49 >AB018276-1|BAA34453.2| 698|Homo sapiens KIAA0733 protein protein. Length = 698 Score = 33.9 bits (74), Expect = 0.62 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +2 Query: 533 QLFHELKQKYPGVPDHVVSHTIELYGHNKQACETHLHSE 649 Q+ H+L+QK+P VP+ VVS + +N AC L E Sbjct: 16 QVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQE 54 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,941,989 Number of Sequences: 237096 Number of extensions: 2075002 Number of successful extensions: 3664 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 3629 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3664 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8903143626 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -