BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30732 (723 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 25 0.55 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 23 2.9 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 8.9 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 8.9 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 25.4 bits (53), Expect = 0.55 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 644 SSPATSQRVPMFPPAWNCRIVS 709 SSPAT+ + PPA++C VS Sbjct: 1257 SSPATALMLQHAPPAYSCGTVS 1278 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 23.0 bits (47), Expect = 2.9 Identities = 17/50 (34%), Positives = 21/50 (42%) Frame = -3 Query: 346 KISRSAHSRFWFDNALCFTFKIRINKTLVLSIYEYKNKTENVIERKKCNS 197 K+S S WF F F + V +IY K KT + KK NS Sbjct: 287 KVSYIKASEIWFLGCTIFLFAAMVEFAFVNTIYRRK-KT---VPLKKVNS 332 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 Query: 629 ATFIADFITASSLPL 585 A F DFIT ++LPL Sbjct: 176 AIFDGDFITENNLPL 190 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 650 PATSQRVPMFPPAWNC 697 PATS VP+ +NC Sbjct: 285 PATSDAVPLLGTYFNC 300 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,206 Number of Sequences: 438 Number of extensions: 4179 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -