BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30730 (739 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 26 0.42 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 24 1.7 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 3.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 3.0 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 23 4.0 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.8 bits (54), Expect = 0.42 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +1 Query: 637 AGSITDLLRGVGNGNDATGLVANAQRYIAQAASQ 738 +G + L RG +GN+ +G AN+Q+ Q + + Sbjct: 1554 SGLVVQLQRGYNSGNNRSGEQANSQQQQQQQSGE 1587 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 23.8 bits (49), Expect = 1.7 Identities = 7/21 (33%), Positives = 18/21 (85%) Frame = -2 Query: 375 IQVLSHVSEEGTERLSEAGEV 313 ++ +S+V ++GTE ++++G+V Sbjct: 184 LESISYVKDDGTEGIAKSGDV 204 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.0 bits (47), Expect = 3.0 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +3 Query: 576 HRCLHHRSLTSSGCSSVPP 632 H ++H + GC+S PP Sbjct: 1738 HSFMYHEHAMTEGCASPPP 1756 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.0 bits (47), Expect = 3.0 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +3 Query: 576 HRCLHHRSLTSSGCSSVPP 632 H ++H + GC+S PP Sbjct: 1734 HSFMYHEHAMTEGCASPPP 1752 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 22.6 bits (46), Expect = 4.0 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +2 Query: 245 VSPVMPVQPLTSLTLTQTASGPETSPASDNLSVPSSDTWDKT*ILSINSS 394 V + +QP LTL++ S S N +V + + T ILS++++ Sbjct: 466 VHDTLQIQPQEQLTLSKVTSNYHEEFQSLNNAVGEMEATNVTNILSMDNT 515 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.316 0.131 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,248 Number of Sequences: 438 Number of extensions: 4207 Number of successful extensions: 88 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -