BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30729 (722 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g26810.1 68417.m03861 SWIB complex BAF60b domain-containing p... 29 4.1 At4g23740.1 68417.m03415 leucine-rich repeat transmembrane prote... 28 5.5 At4g13060.1 68417.m02037 F-box family protein-related contains T... 27 9.5 >At4g26810.1 68417.m03861 SWIB complex BAF60b domain-containing protein contains Pfam profile PF02201: BAF60b domain of the SWIB complex Length = 106 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 527 DVENFPNEYHNCNYSFSINDLLCFPSVWNNIRLDGLQSRKD 649 D+ N P+ N I+ L CF VW+ I+ + LQ K+ Sbjct: 22 DLVNLPSTLRNFVGQSQISRLGCFMRVWSYIKTNNLQDPKN 62 >At4g23740.1 68417.m03415 leucine-rich repeat transmembrane protein kinase, putative receptor-like protein kinase - Arabidopsis thaliana RKL1, PID:g4008006 Length = 638 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 521 VSDVENFPNEYHNCNYSFSINDLL 592 + DV N + + CNYSF + DLL Sbjct: 313 MEDVNNRLSFFEGCNYSFDLEDLL 336 >At4g13060.1 68417.m02037 F-box family protein-related contains TIGRFAM TIGR01640: F-box protein interaction domain Length = 335 Score = 27.5 bits (58), Expect = 9.5 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +2 Query: 476 KILYRKTL*HILFDLVSDVENFPN-----EYHNCNYSFSINDLLCF 598 ++LY + H F SDV NF N + H NYS S+N L+ F Sbjct: 9 QVLYMLSF-HENFKSYSDVNNFHNMPPTEDCHYYNYSASVNGLVTF 53 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,129,822 Number of Sequences: 28952 Number of extensions: 264795 Number of successful extensions: 646 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 634 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1575119672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -