BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30727 (683 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 6.3 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 6.3 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 8.3 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 8.3 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 8.3 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 8.3 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 475 EKDEDGLTALHWAADR 522 E+ EDG LH+ +DR Sbjct: 124 ERPEDGALILHYYSDR 139 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 475 EKDEDGLTALHWAADR 522 E+ EDG LH+ +DR Sbjct: 124 ERPEDGALILHYYSDR 139 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +1 Query: 295 SGTPQKTNIDTKETWVAVSSMRYSPEPDLVH 387 SG T ++ +S YS PDL+H Sbjct: 639 SGAKSPTVLEELTHGTLAASTLYSKRPDLLH 669 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +1 Query: 295 SGTPQKTNIDTKETWVAVSSMRYSPEPDLVH 387 SG T ++ +S YS PDL+H Sbjct: 639 SGAKSPTVLEELTHGTLAASTLYSKRPDLLH 669 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +1 Query: 295 SGTPQKTNIDTKETWVAVSSMRYSPEPDLVH 387 SG T ++ +S YS PDL+H Sbjct: 639 SGAKSPTVLEELTHGTLAASTLYSKRPDLLH 669 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 8.3 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +1 Query: 34 QSPLDSLFNKAADHLRKVTNKLNNGQLLELYGLFKQ 141 QSP + L KV N+GQL+ + L Q Sbjct: 1100 QSPHQQQQQQQQKILAKVLTSSNSGQLISVENLLAQ 1135 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.311 0.131 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,896 Number of Sequences: 438 Number of extensions: 3886 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -