BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30722 (773 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17G8.02 |||uridine ribohydrolase |Schizosaccharomyces pombe|... 26 5.2 SPBC21B10.07 |||glycosyl hydrolase family 16|Schizosaccharomyces... 26 5.2 >SPAC17G8.02 |||uridine ribohydrolase |Schizosaccharomyces pombe|chr 1|||Manual Length = 330 Score = 26.2 bits (55), Expect = 5.2 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 292 LFQVPIFINHKH*HTVNLV*YYIKIVNPLSRTVSKGPD*FQTTY 161 LF VP+ + HK N++ + NP S T+ + FQ TY Sbjct: 201 LFMVPLDVTHKVLLDANIIQLLRQHSNPFSSTLVELMTVFQQTY 244 >SPBC21B10.07 |||glycosyl hydrolase family 16|Schizosaccharomyces pombe|chr 2|||Manual Length = 419 Score = 26.2 bits (55), Expect = 5.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 46 LGHHLVIIIRHRSHKQK*YGL*HKYK 123 LGH + RH S+K K Y L +YK Sbjct: 111 LGHRTAVRDRHPSYKAKTYSLVKEYK 136 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,782,144 Number of Sequences: 5004 Number of extensions: 54684 Number of successful extensions: 102 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 373338084 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -