BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30722 (773 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 23 3.2 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 23 3.2 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 23 3.2 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 7.3 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 7.3 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.0 bits (47), Expect = 3.2 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +2 Query: 164 SSLKLVRSFTHSP*QRVNNFNIVSYQIDSMLVFMI 268 ++L ++ FT+ P + V NF IVS + + V ++ Sbjct: 54 NALVILSVFTYRPLRIVQNFFIVSLAVADLAVAIL 88 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.0 bits (47), Expect = 3.2 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +2 Query: 164 SSLKLVRSFTHSP*QRVNNFNIVSYQIDSMLVFMI 268 ++L ++ FT+ P + V NF IVS + + V ++ Sbjct: 54 NALVILSVFTYRPLRIVQNFFIVSLAVADLAVAIL 88 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 23.0 bits (47), Expect = 3.2 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +2 Query: 164 SSLKLVRSFTHSP*QRVNNFNIVSYQIDSMLVFMI 268 ++L ++ FT+ P + V NF IVS + + V ++ Sbjct: 54 NALVILSVFTYRPLRIVQNFFIVSLAVADLAVAIL 88 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.8 bits (44), Expect = 7.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 403 SIYSLLFTALGKSPLTGRNVCKL 471 SI + ALG+ PLT +N+ +L Sbjct: 148 SILPIFLYALGEQPLTEQNLEEL 170 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 7.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 403 SIYSLLFTALGKSPLTGRNVCKL 471 SI + ALG+ PLT +N+ +L Sbjct: 186 SILPIFLYALGEQPLTEQNLEEL 208 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,909 Number of Sequences: 438 Number of extensions: 3970 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -